PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Oropetium_20150105_10818A

Organism

Oropetium thomaeum

Taxonomic ID

1148796

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium

Family

MYB

Protein Properties

Length: 182aa MW: 20107.9 Da PI: 9.6532

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Oropetium_20150105_10818A	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.4	1.4e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv +++ +G g+W++ ++ g+ R++k+c++rw +yl Oropetium_20150105_10818A 14 KGAWTKEEDQRLVAYIRAHGEGCWRSLPKAAGLQRCGKSCRLRWINYL 61 79********************************************97 PP
2	Myb_DNA-binding	54	3.7e-17	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T eE + ++++++ lG++ W++Ia++++ gRt++++k++w+++ Oropetium_20150105_10818A 67 RGNFTDEEVDTIIKLHQILGNK-WSLIAARLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.0E-25	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.504	9	61	IPR017930	Myb domain
SMART	SM00717	7.2E-13	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.49E-29	13	108	IPR009057	Homeodomain-like
Pfam	PF00249	1.8E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	7.92E-11	16	61	No hit	No description
PROSITE profile	PS51294	26.718	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.1E-27	65	117	IPR009057	Homeodomain-like
SMART	SM00717	2.0E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-15	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	5.67E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 182 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIR AHGEGCWRSL PKAAGLQRCG KSCRLRWINY 60 LRPDLKRGNF TDEEVDTIIK LHQILGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLIACG 120 IDPQTHRPLR VSAAAAATAR TSGQLETRTS CSPASSSDED SMPAQHLAGS IDLNLSLSLS 180 T*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-29	14	116	7	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Oropetium_20150105_10818A

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM156905	1e-138	AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene).
GenBank	EU963911	1e-138	EU963911.1 Zea mays clone 274019 hypothetical protein mRNA, complete cds.
GenBank	HQ858692	1e-138	HQ858692.1 Zea mays clone UT1148 ZmMYB8 transcription factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004977234.1	2e-97	myb-related protein Zm38
Swissprot	Q9SZP1	8e-86	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	K3YA56	4e-96	K3YA56_SETIT; Uncharacterized protein
STRING	Si011098m	6e-97	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	3e-85	myb domain protein 4

Link Out ? help Back to Top
Phytozome	Oropetium_20150105_10818A

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]