![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_14389A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 162aa MW: 17586 Da PI: 9.4576 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 110.5 | 1.3e-34 | 37 | 122 | 53 | 138 |
Whirly 53 qsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrs 136
+ f+ls+tev++l++l++ esceffhdp++k+s eG+v+k+l++ Pl + sG+fvnl+v n+l+k+ +++svP++k+efavlr+
Oropetium_20150105_14389A 37 ELFSLSPTEVGSLISLGPAESCEFFHDPSMKSSLEGQVKKSLSLTPLGNDSGYFVNLTVLNNLQKTTDRLSVPITKGEFAVLRT 120
67*********************************************************************************9 PP
Whirly 137 ll 138
l
Oropetium_20150105_14389A 121 TL 122
76 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 7.1E-8 | 5 | 37 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 1.73E-50 | 8 | 161 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 3.3E-32 | 36 | 120 | IPR013742 | Plant transcription factor |
| Gene3D | G3DSA:2.30.31.10 | 2.5E-40 | 38 | 142 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 162 aa Download sequence Send to blast |
MGGRDSSSGK KYASYTVFKG KAALSVHPIL PSFSKLELFS LSPTEVGSLI SLGPAESCEF 60 FHDPSMKSSL EGQVKKSLSL TPLGNDSGYF VNLTVLNNLQ KTTDRLSVPI TKGEFAVLRT 120 TLGYALPRIM GWDQALANHH PAPQASKPRV ERPHPDSEWE R* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3n1h_A | 2e-46 | 9 | 134 | 9 | 165 | StWhy2 |
| 3n1i_A | 2e-46 | 9 | 134 | 9 | 165 | protein StWhy2 |
| 3n1j_A | 2e-46 | 9 | 134 | 9 | 165 | Protein StWhy2 |
| 3n1k_A | 2e-46 | 9 | 134 | 9 | 165 | protein StWhy2 |
| 3n1l_A | 2e-46 | 9 | 134 | 9 | 165 | protein StWhy2 |
| 4kop_A | 3e-46 | 8 | 134 | 8 | 165 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_B | 3e-46 | 8 | 134 | 8 | 165 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_C | 3e-46 | 8 | 134 | 8 | 165 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_D | 3e-46 | 8 | 134 | 8 | 165 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_14389A |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004951836.1 | 5e-89 | single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| Swissprot | Q8VYF7 | 2e-46 | WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A1E5VBK3 | 2e-93 | A0A1E5VBK3_9POAL; Single-stranded DNA-bindig protein WHY2, mitochondrial | ||||
| STRING | Si018290m | 3e-88 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3012 | 38 | 85 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 8e-49 | WHIRLY 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_14389A |




