PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_14597A
Organism
Oropetium thomaeum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 115aa    MW: 13214.2 Da    PI: 10.2114
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_14597AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-113188562
                               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                               kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  +  l ++
  Oropetium_20150105_14597A 31 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDSTGLATQ 88
                               899*******************************************999887766665 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-182791IPR004827Basic-leucine zipper domain
PfamPF077162.5E-102880IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.8292992IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.41E-123185No hitNo description
Gene3DG3DSA:1.20.5.1705.3E-133184No hitNo description
CDDcd147037.55E-183283No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0010628Biological Processpositive regulation of gene expression
GO:0010629Biological Processnegative regulation of gene expression
GO:0090567Biological Processreproductive shoot system development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MEFTNGEFSE AEKKKIMANE RLAEIALTDP KRVKRILANR QSAARSKERK MRYIQELEHK  60
VQVLQTEATT LSAQLTMLQR DSTGLATQNN ELKIRLQAME QQAQLRDGML ITFY*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00037PBMTransfer from AT2G21230Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_14597A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0696231e-111BT069623.1 Zea mays full-length cDNA clone ZM_BFb0192H19 mRNA, complete cds.
GenBankKJ7277391e-111KJ727739.1 Zea mays clone pUT5680 bZIP transcription factor (bZIP43) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147562.13e-66uncharacterized protein LOC100281171
RefseqXP_006660351.19e-67PREDICTED: transcription factor RF2a-like
SwissprotQ6S4P48e-44RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A287WLE93e-67A0A287WLE9_HORVV; Uncharacterized protein
STRINGEMT205202e-67(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.32e-54bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]