![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_17511A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 137aa MW: 14991.7 Da PI: 11.1649 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 48.5 | 1.9e-15 | 54 | 114 | 1 | 61 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
+ke +r +r+ +NR++A+ R+RKk+++ eLe +vk Le+ N++L ++l++l++e + l++
Oropetium_20150105_17511A 54 DKEHRRLKRLLRNRVSAQQARERKKQYLTELEVRVKDLEKRNSELEERLSTLQNENQMLRQ 114
58899***************************************************98876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PRINTS | PR00041 | 9.8E-5 | 53 | 69 | IPR001630 | cAMP response element binding (CREB) protein |
| SMART | SM00338 | 2.0E-14 | 54 | 118 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 1.7E-13 | 55 | 114 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 12.702 | 56 | 119 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 5.5E-17 | 58 | 118 | No hit | No description |
| SuperFamily | SSF57959 | 3.06E-13 | 58 | 116 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 61 | 76 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14704 | 2.76E-13 | 68 | 110 | No hit | No description |
| PRINTS | PR00041 | 9.8E-5 | 71 | 91 | IPR001630 | cAMP response element binding (CREB) protein |
| PRINTS | PR00041 | 9.8E-5 | 91 | 108 | IPR001630 | cAMP response element binding (CREB) protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 137 aa Download sequence Send to blast |
MESDVEIRRV PEFGTAEQAG PSTSSGKETA AAAGTSSLAI QAATARRSGR SSADKEHRRL 60 KRLLRNRVSA QQARERKKQY LTELEVRVKD LEKRNSELEE RLSTLQNENQ MLRQVLKNTT 120 VNRRGPGGSS AGGDGK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2oqq_A | 9e-16 | 80 | 118 | 4 | 42 | Transcription factor HY5 |
| 2oqq_B | 9e-16 | 80 | 118 | 4 | 42 | Transcription factor HY5 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_17511A |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010925239.1 | 1e-56 | transcription factor HY5 isoform X2 | ||||
| Swissprot | Q9SM50 | 1e-46 | HY5_SOLLC; Transcription factor HY5 | ||||
| TrEMBL | A0A2H3XK35 | 6e-55 | A0A2H3XK35_PHODC; transcription factor HY5-like isoform X1 | ||||
| TrEMBL | A0A2H3XK82 | 5e-55 | A0A2H3XK82_PHODC; transcription factor HY5-like isoform X2 | ||||
| STRING | XP_008784994.1 | 1e-55 | (Phoenix dactylifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1408 | 38 | 111 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G11260.1 | 3e-44 | bZIP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_17511A |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




