![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_19180A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 83aa MW: 9404.49 Da PI: 4.5027 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 44.5 | 3.8e-14 | 3 | 41 | 57 | 95 |
NF-YB 57 ekrktingddllwalatlGfedyveplkvylkkyreleg 95
++r+ti+++d++w++ lGf+dyvep ++y+++yre ++
Oropetium_20150105_19180A 3 QHRRTIAPEDFIWSFERLGFDDYVEPRSTYIRRYRENQN 41
79*********************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 6.58E-8 | 2 | 43 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-9 | 3 | 42 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MAQHRRTIAP EDFIWSFERL GFDDYVEPRS TYIRRYRENQ NAGGIVPQPC PSPPQVVSSF 60 TDEEVQFLKS VVPLPCDDVT SS* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May act through association with MADS-box proteins. May regulate the expression of genes involved in flowering. {ECO:0000269|PubMed:11971906}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_19180A |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006649006.1 | 8e-19 | PREDICTED: nuclear transcription factor Y subunit B-1-like | ||||
| Swissprot | Q6Z348 | 6e-17 | NFYB1_ORYSJ; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A0D9VKG6 | 2e-18 | A0A0D9VKG6_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A0A0E0K4P7 | 2e-18 | A0A0E0K4P7_ORYPU; Uncharacterized protein | ||||
| STRING | OPUNC02G28490.1 | 4e-19 | (Oryza punctata) | ||||
| STRING | LPERR02G25190.1 | 3e-19 | (Leersia perrieri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP13659 | 26 | 31 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 3e-11 | nuclear factor Y, subunit B6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_19180A |




