![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_22089A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 91aa MW: 9505.58 Da PI: 6.8837 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 101.3 | 6.5e-32 | 20 | 74 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
v+Y+eC++NhAa++Gg+avDGC+Efm+ g+egta+al CaACgCHR+FHRrev+
Oropetium_20150105_22089A 20 VVHYRECQRNHAAAIGGYAVDGCREFMAL-GAEGTAEALLCAACGCHRSFHRREVV 74
699*************************9.999********************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 9.0E-11 | 17 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 5.6E-30 | 21 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 6.8E-26 | 22 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.889 | 23 | 72 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MGPKQQDANG TAARKETKAV VHYRECQRNH AAAIGGYAVD GCREFMALGA EGTAEALLCA 60 ACGCHRSFHR REVVEPADCD CSSTTTTTSG * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_22089A |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025808589.1 | 5e-44 | mini zinc finger protein 1-like | ||||
| Refseq | XP_025827869.1 | 5e-44 | mini zinc finger protein 1-like | ||||
| Swissprot | B8BIU8 | 2e-30 | MIF1_ORYSI; Mini zinc finger protein 1 | ||||
| Swissprot | Q2RB28 | 2e-30 | MIF1_ORYSJ; Mini zinc finger protein 1 | ||||
| TrEMBL | A0A270R7F7 | 1e-42 | A0A270R7F7_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.J13295.1.p | 4e-42 | (Panicum virgatum) | ||||
| STRING | Si027403m | 5e-42 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 3e-16 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_22089A |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




