![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_23235A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 265aa MW: 27244.6 Da PI: 6.3957 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 162 | 8.8e-51 | 58 | 146 | 9 | 97 |
NF-YB 9 PianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
ianvsrimk+ lPanakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe yv plk yl++yre
Oropetium_20150105_23235A 58 XIANVSRIMKRSLPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEAYVGPLKSYLNRYRE 141
69********************************************************************************** PP
NF-YB 93 legek 97
+egek
Oropetium_20150105_23235A 142 AEGEK 146
**997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 2.58E-35 | 59 | 168 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.7E-24 | 59 | 120 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 1.3E-45 | 59 | 150 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 3.9E-18 | 84 | 102 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 87 | 103 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.9E-18 | 103 | 121 | No hit | No description |
| PRINTS | PR00615 | 3.9E-18 | 122 | 140 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 265 aa Download sequence Send to blast |
MKSRKGYAQQ GHLLSPVGSP PSDNESGAAA AAAAAGCAAY GGXXXXXXXX XXXXXXXXIA 60 NVSRIMKRSL PANAKISKDA KETVQECVSE FISFVTGEAS DKCQREKRKT INGDDLLWAM 120 TTLGFEAYVG PLKSYLNRYR EAEGEKAAVL GGARHGDGGA SDDVAGGGGG HIPGGNRGDH 180 DGXXXXXXXX XXHDAHVGLM MGVSVGFSAG GGTSYYSTPA AGTKAYGGEG SAKLVEFDGI 240 AAEEDNGGGV QRGFGGHLNG GVQW* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 1e-39 | 59 | 141 | 15 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:20566706, PubMed:21148627). Regulates plant height by promoting cell elongation in the internodes (PubMed:20566706). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:20566706, ECO:0000269|PubMed:21148627}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_23235A |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269|PubMed:26542958}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB124648 | 1e-139 | AB124648.1 Oryza sativa Indica Group Hd5 gene for Heading date 5, complete cds, cultivar:Kasalath. | |||
| GenBank | AB124649 | 1e-139 | AB124649.1 Oryza sativa Indica Group Hd5 mRNA for Heading date 5, complete cds, cultivar:Kasalath. | |||
| GenBank | AY062182 | 1e-139 | AY062182.1 Oryza sativa (indica cultivar-group) HAP3-like transcriptional-activator (HAP3b) mRNA, complete cds. | |||
| GenBank | CP012616 | 1e-139 | CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence. | |||
| GenBank | CT837794 | 1e-139 | CT837794.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA121O04, full insert sequence. | |||
| GenBank | KR815350 | 1e-139 | KR815350.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds. | |||
| GenBank | KR815351 | 1e-139 | KR815351.1 Oryza sativa days to heading 8 (DTH8) gene, partial cds. | |||
| GenBank | LC016712 | 1e-139 | LC016712.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Qiu Zhao Zong. | |||
| GenBank | LC016713 | 1e-139 | LC016713.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Tupa 121-3. | |||
| GenBank | LC016714 | 1e-139 | LC016714.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Muha. | |||
| GenBank | LC016716 | 1e-139 | LC016716.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Deng Pao Zhai. | |||
| GenBank | LC016718 | 1e-139 | LC016718.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Naba. | |||
| GenBank | LC016719 | 1e-139 | LC016719.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bei Khe. | |||
| GenBank | LC016721 | 1e-139 | LC016721.1 Oryza sativa Indica Group Hd5 gene for heading date 5, complete cds, cultivar: Bleiyo. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002445142.1 | 1e-97 | nuclear transcription factor Y subunit B-11 | ||||
| Swissprot | Q0J7P4 | 1e-64 | HD5_ORYSJ; Nuclear transcription factor Y subunit B-11 | ||||
| TrEMBL | A0A3L6PMD7 | 5e-98 | A0A3L6PMD7_PANMI; Uncharacterized protein | ||||
| STRING | Sb07g004740.1 | 4e-97 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 2e-55 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_23235A |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




