![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_23360A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 132aa MW: 14202.1 Da PI: 9.7915 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 25.5 | 3e-08 | 92 | 121 | 3 | 32 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmg 32
+WT+eE+ ++ + ++lG+g+W+ +++++
Oropetium_20150105_23360A 92 PWTEEEHRTFLAGLEKLGKGDWRVTSAKLP 121
8*********************97666666 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50090 | 6.098 | 85 | 131 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 2.03E-6 | 86 | 115 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.5E-7 | 88 | 114 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 6.8E-6 | 92 | 121 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.7E-7 | 92 | 122 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.41E-6 | 92 | 122 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 132 aa Download sequence Send to blast |
MPRDSRPAGM RLFGVTIAPA PEADAPDRDL SPNPPLAARE DVMRKCKSMC NLAAAGASMD 60 GSAAADGYLS DDGLMQSSGK RRRAQERKKA VPWTEEEHRT FLAGLEKLGK GDWRVTSAKL 120 PHITTPRDKN A* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_23360A |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU961918 | 1e-49 | EU961918.1 Zea mays clone 239020 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008676506.1 | 1e-58 | putative MYB DNA-binding domain superfamily protein isoform X1 | ||||
| Swissprot | Q7XC57 | 8e-17 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
| TrEMBL | C4J012 | 3e-57 | C4J012_MAIZE; MYB-related transcription factor | ||||
| STRING | GRMZM2G157306_P02 | 4e-57 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5858 | 36 | 52 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G16350.1 | 1e-15 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_23360A |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




