![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_25800A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | E2F/DP | ||||||||
| Protein Properties | Length: 79aa MW: 9389.91 Da PI: 9.5108 | ||||||||
| Description | E2F/DP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | E2F_TDP | 53.8 | 3.1e-17 | 6 | 38 | 38 | 71 |
E2F_TDP 38 dvknkrRRiYDilNVLealnliekkekneirwkg 71
d+kn+rRR+YD+lNVL+a+++i+k +k+ei+wkg
Oropetium_20150105_25800A 6 DEKNIRRRVYDALNVLMAMEIISK-DKKEIQWKG 38
789*********************.*******98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01372 | 5.3E-4 | 1 | 38 | IPR003316 | E2F/DP family, winged-helix DNA-binding domain |
| Gene3D | G3DSA:1.10.10.10 | 2.9E-23 | 2 | 44 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.9E-12 | 3 | 39 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF02319 | 7.6E-15 | 3 | 38 | IPR003316 | E2F/DP family, winged-helix DNA-binding domain |
| SuperFamily | SSF144074 | 4.71E-5 | 45 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005667 | Cellular Component | transcription factor complex | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 79 aa Download sequence Send to blast |
MQQQYDEKNI RRRVYDALNV LMAMEIISKD KKEIQWKGLP RTSMDEIDEL KTEIMGMKGR 60 IEKKSAYLQD LQDQLRQK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1cf7_B | 7e-17 | 5 | 43 | 55 | 93 | PROTEIN (TRANSCRIPTION FACTOR DP-2) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in the regulation of the G1/S transition. Increases the DNA binding activity of E2F proteins after heterodimerization. The complex DPB/E2FC restricts cell division and lateral root initiation and may function as a negative regulator of E2F-regulated genes. The interaction with SKP2A is controlled by auxin. {ECO:0000269|PubMed:11891240, ECO:0000269|PubMed:16920782}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_25800A |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT036566 | 5e-63 | BT036566.1 Zea mays full-length cDNA clone ZM_BFb0123L22 mRNA, complete cds. | |||
| GenBank | BT041080 | 5e-63 | BT041080.1 Zea mays full-length cDNA clone ZM_BFc0172H21 mRNA, complete cds. | |||
| GenBank | EU975275 | 5e-63 | EU975275.1 Zea mays clone 486268 transcription factor Dp-1 mRNA, complete cds. | |||
| GenBank | HQ858767 | 5e-63 | HQ858767.1 Zea mays clone UT1683 E2F-DP transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001141328.1 | 2e-39 | uncharacterized protein LOC100273419 isoform 1 | ||||
| Refseq | XP_020408751.1 | 6e-39 | uncharacterized protein LOC100273419 isoform X4 | ||||
| Swissprot | Q9FNY2 | 3e-31 | DPB_ARATH; Transcription factor-like protein DPB | ||||
| TrEMBL | A0A3L6EK81 | 2e-39 | A0A3L6EK81_MAIZE; Transcription factor-like protein DPB | ||||
| STRING | MLOC_79152.2 | 3e-39 | (Hordeum vulgare) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1283 | 38 | 109 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G03415.2 | 7e-34 | Transcription factor DP | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_25800A |




