![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Oropetium_20150105_26940A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 142aa MW: 15582.6 Da PI: 5.8059 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 177.2 | 1.5e-55 | 17 | 112 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85
+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++
Oropetium_20150105_26940A 17 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRR 100
89********************************************************************************** PP
NF-YB 86 ylkkyrelegek 97
yl+kyre+eg++
Oropetium_20150105_26940A 101 YLHKYREVEGDR 112
**********97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.2E-50 | 14 | 117 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.9E-39 | 19 | 118 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.2E-27 | 22 | 85 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.3E-17 | 50 | 68 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 53 | 69 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.3E-17 | 69 | 87 | No hit | No description |
| PRINTS | PR00615 | 1.3E-17 | 88 | 106 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 142 aa Download sequence Send to blast |
MADQPDGRPG AAADEIKEQD RLLPIANVGR IMKQILPPNA KISKEAKETM QECVSEFISF 60 VTGEASDKCH KEKRKTVNGD DVCWAFGALG FDDYVDPMRR YLHKYREVEG DRAAAAASSR 120 GPPPTLAPGL LDRAGPNYFC SP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-43 | 16 | 107 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Oropetium_20150105_26940A |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU970198 | 1e-138 | EU970198.1 Zea mays clone 342117 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015635864.1 | 5e-69 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_015635872.1 | 5e-69 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | O82248 | 2e-56 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A0D3EYD4 | 1e-67 | A0A0D3EYD4_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A0A0E0JTD0 | 2e-67 | A0A0E0JTD0_ORYPU; Uncharacterized protein | ||||
| TrEMBL | A0A0E0N7B5 | 1e-67 | A0A0E0N7B5_ORYRU; Uncharacterized protein | ||||
| TrEMBL | I1NUZ7 | 1e-67 | I1NUZ7_ORYGL; Uncharacterized protein | ||||
| TrEMBL | Q942Y5 | 1e-67 | Q942Y5_ORYSJ; HAP3 subunit of HAP complex | ||||
| STRING | ORUFI01G46550.1 | 2e-68 | (Oryza rufipogon) | ||||
| STRING | OS01T0935200-01 | 2e-68 | (Oryza sativa) | ||||
| STRING | OPUNC01G42210.1 | 3e-68 | (Oryza punctata) | ||||
| STRING | ORGLA01G0368700.1 | 2e-68 | (Oryza glaberrima) | ||||
| STRING | OBART01G43130.1 | 2e-68 | (Oryza barthii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 4e-58 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Oropetium_20150105_26940A |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




