PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Oropetium_20150105_28341A

Organism

Oropetium thomaeum

Taxonomic ID

1148796

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium

Family

M-type_MADS

Protein Properties

Length: 68aa MW: 7272.52 Da PI: 11.3909

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Oropetium_20150105_28341A	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	90.1	1.1e-28	9	52	1	44
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44 krienk+nrqvtfskRrng+lKKA+E+SvLCdaevavi+fs++g Oropetium_20150105_28341A 9 KRIENKINRQVTFSKRRNGLLKKANEISVLCDAEVAVIVFSPKG 52 79****************************************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.0E-37	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.7E-27	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	28.749	1	52	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.09E-33	2	57	No hit	No description
PRINTS	PR00404	2.2E-26	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.1E-25	10	53	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-26	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 68 aa Download sequence Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KANEISVLCD AEVAVIVFSP KGSSTSTPPT 60 SGRVVCA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-16	1	49	1	49	MEF2 CHIMERA
6byy_B	1e-16	1	49	1	49	MEF2 CHIMERA
6byy_C	1e-16	1	49	1	49	MEF2 CHIMERA
6byy_D	1e-16	1	49	1	49	MEF2 CHIMERA
6bz1_A	1e-16	1	49	1	49	MEF2 CHIMERA
6bz1_B	1e-16	1	49	1	49	MEF2 CHIMERA
6bz1_C	1e-16	1	49	1	49	MEF2 CHIMERA
6bz1_D	1e-16	1	49	1	49	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Oropetium_20150105_28341A

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY198327	5e-69	AY198327.1 Lolium perenne MADS2 mRNA, complete cds.
GenBank	HQ588324	5e-69	HQ588324.1 Brachypodium distachyon MADS-box (AP1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001105333.2	4e-26	zea apetala homolog 1
Refseq	XP_007156376.1	6e-27	hypothetical protein PHAVU_003G2810000g, partial
Refseq	XP_019438988.1	1e-26	PREDICTED: truncated transcription factor CAULIFLOWER A isoform X2
Refseq	XP_020149442.1	4e-26	MADS-box transcription factor 15-like
Refseq	XP_020234510.1	1e-26	truncated transcription factor CAULIFLOWER A
Refseq	XP_027333787.1	1e-26	truncated transcription factor CAULIFLOWER D isoform X2
Refseq	XP_028095641.1	1e-26	agamous-like MADS-box protein AGL8
Swissprot	Q6Q9I2	6e-27	MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBL	A0A453BPV8	3e-29	A0A453BPV8_AEGTS; Uncharacterized protein
STRING	Pavir.Ba03990.1.p	1e-29	(Panicum virgatum)
STRING	Pavir.Bb00065.1.p	7e-30	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60910.1	4e-26	AGAMOUS-like 8

Link Out ? help Back to Top
Phytozome	Oropetium_20150105_28341A

Publications ? help Back to Top
Cai Q, et al. [PAEs in composts of municipal sludge and rice straw]. Ying Yong Sheng Tai Xue Bao, 2003. 14(11): p. 1993-6 [PMID:14997664] Wang K, et al. DEP and AFO regulate reproductive habit in rice. PLoS Genet., 2010. 6(1): p. e1000818 [PMID:20107517] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Ramanujam R,Yishi X,Liu H,Naqvi NI Structure-function analysis of Rgs1 in Magnaporthe oryzae: role of DEP domains in subcellular targeting. PLoS ONE, 2012. 7(7): p. e41084 [PMID:22927898] Ang TN,Ngoh GC,Chua AS,Lee MG Elucidation of the effect of ionic liquid pretreatment on rice husk via structural analyses. Biotechnol Biofuels, 2012. 5(1): p. 67 [PMID:22958710] Zhang G,Huang K,Jiang X,Huang D,Yang Y Acetylation of rice straw for thermoplastic applications. Carbohydr Polym, 2013. 96(1): p. 218-26 [PMID:23688473] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Hu S, et al. A point mutation in the zinc finger motif of RID1/EHD2/OsID1 protein leads to outstanding yield-related traits in japonica rice variety Wuyunjing 7. Rice (N Y), 2013. 6(1): p. 24 [PMID:24280027] Ji Y, et al. A comprehensive assessment of human exposure to phthalates from environmental media and food in Tianjin, China. J. Hazard. Mater., 2014. 279: p. 133-40 [PMID:25051237] Huang Y, et al. Phthalates in Commercial Chinese Rice Wines: Concentrations and the Cumulative Risk Assessment to Adult Males in Shanghai. Biomed. Environ. Sci., 2014. 27(10): p. 819-23 [PMID:25341819] Tamaki S, et al. FT-like proteins induce transposon silencing in the shoot apex during floral induction in rice. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(8): p. E901-10 [PMID:25675495] Wu F, et al. The ABCs of flower development: mutational analysis of AP1/FUL-like genes in rice provides evidence for a homeotic (A)-function in grasses. Plant J., 2017. 89(2): p. 310-324 [PMID:27689766]