PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100015450041

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

ZF-HD

Protein Properties

Length: 79aa MW: 8859.03 Da PI: 9.0424

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100015450041	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	104.7	5.6e-33	21	77	3	59
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 +v+Y+eC+kNhAas+Gg+avDGC+Ef++++ge+g++aal CaACgCHRnFHRr+ ++ Ote100015450041\|100015450041 21 GVHYRECMKNHAASIGGYAVDGCREFLAERGEDGSSAALSCAACGCHRNFHRRQAVY 77 689**************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	4.0E-12	1	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	9.6E-29	22	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.6E-26	23	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.8	24	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 79 aa Download sequence Send to blast
MKRKHIVIRK DLYQRSSSVV GVHYRECMKN HAASIGGYAV DGCREFLAER GEDGSSAALS 60 CAACGCHRNF HRRQAVYNE

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015583772.1	4e-29	mini zinc finger protein 2
Swissprot	Q9LJW5	1e-25	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	B9T6Z4	8e-28	B9T6Z4_RICCO; Transcription factor, putative
STRING	XP_002534013.1	1e-28	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]