PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100018490011

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

NAC

Protein Properties

Length: 233aa MW: 26119.2 Da PI: 5.97

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100018490011	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	166.1	1.2e-51	25	155	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkk..leleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknra 77 l+pGfrFhPtdeelv +yL++k+ gk+ ++e+d+yk+ePw+L +++k+++ ewyfFs+ d+ky +g+r nra Ote100018490011\|100018490011 25 LAPGFRFHPTDEELVRYYLRRKACGKPxxXXXXXXVTEIDVYKSEPWELAdySSLKTRDLEWYFFSPVDRKYGNGSRLNRA 105 579**********************64333346**********84347777888***************** PP NAM 78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 t +gyWkatgkd++v + k++++g+kktLvf++grap+g++t+Wvmheyrl Ote100018490011\|100018490011 106 TGKGYWKATGKDRAVRH-KNQTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 155 *************.9999*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.02E-61	23	178	IPR003441	NAC domain
PROSITE profile	PS51005	57.442	25	178	IPR003441	NAC domain
Pfam	PF02365	8.4E-29	27	155	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 233 aa Download sequence Send to blast
MGQEVVVAVT AAQPAGGGAP PPTSLAPGFR FHPTDEELVR YYLRRKACGK PXXXXXXXXV 60 TEIDVYKSEP WELADYSSLK TRDLEWYFFS PVDRKYGNGS RLNRATGKGY WKATGKDRAV 120 RHKNQTIGMK KTLVFHSGRA PDGKRTNWVM HEYRLCDSEL ERAGVTQDAF VLCRIFQKSG 180 LGPPNGDRYA PFVEEEWDED AVVVVPGGDA EDDVANGDEA LECTHHDQKD AIF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	7e-50	24	178	16	165	NO APICAL MERISTEM PROTEIN
1ut4_B	7e-50	24	178	16	165	NO APICAL MERISTEM PROTEIN
1ut7_A	7e-50	24	178	16	165	NO APICAL MERISTEM PROTEIN
1ut7_B	7e-50	24	178	16	165	NO APICAL MERISTEM PROTEIN
3swm_A	7e-50	24	178	19	168	NAC domain-containing protein 19
3swm_B	7e-50	24	178	19	168	NAC domain-containing protein 19
3swm_C	7e-50	24	178	19	168	NAC domain-containing protein 19
3swm_D	7e-50	24	178	19	168	NAC domain-containing protein 19
3swp_A	7e-50	24	178	19	168	NAC domain-containing protein 19
3swp_B	7e-50	24	178	19	168	NAC domain-containing protein 19
3swp_C	7e-50	24	178	19	168	NAC domain-containing protein 19
3swp_D	7e-50	24	178	19	168	NAC domain-containing protein 19
4dul_A	7e-50	24	178	16	165	NAC domain-containing protein 19
4dul_B	7e-50	24	178	16	165	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269\|PubMed:19237690, ECO:0000269\|PubMed:24045019, ECO:0000269\|PubMed:25578968, ECO:0000269\|PubMed:26617990, ECO:0000269\|PubMed:28207953}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269\|PubMed:16553893}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011101542.1	1e-145	NAC domain-containing protein 78 isoform X2
Swissprot	Q9SQY0	2e-92	NAC52_ARATH; NAC domain containing protein 52
TrEMBL	A0A2U5FKN3	1e-145	A0A2U5FKN3_SALMI; NAC domain containing protein 2
STRING	Migut.F01688.1.p	1e-134	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3140	24	48

Publications ? help Back to Top
Higgins JD,Ferdous M,Osman K,Franklin FC The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis. Plant J., 2011. 65(3): p. 492-502 [PMID:21265901] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhang S, et al. C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association. Cell Discov, 2019. [PMID:26617990] Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation. Plant J., 2017. 90(3): p. 505-519 [PMID:28207953] Elmayan T, et al. Arabidopsis mutants impaired in cosuppression. Plant Cell, 1998. 10(10): p. 1747-58 [PMID:9761800]