![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100023350051 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 126aa MW: 14624.7 Da PI: 10.3101 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.9 | 4.3e-33 | 47 | 105 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+++r ++d+ +v++tYeg H h+
Ote100023350051|100023350051 47 LDDGYRWRKYGQKAVKNNRFPRSYYRCTHQGCNVKKQIQRLSKDEGIVVTTYEGMHSHP 105
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.1E-34 | 32 | 105 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 9.29E-30 | 39 | 106 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.78 | 42 | 107 | IPR003657 | WRKY domain |
| SMART | SM00774 | 6.5E-38 | 47 | 106 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.8E-26 | 48 | 105 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0000122 | Biological Process | negative regulation of transcription from RNA polymerase II promoter | ||||
| GO:0010055 | Biological Process | atrichoblast differentiation | ||||
| GO:0032107 | Biological Process | regulation of response to nutrient levels | ||||
| GO:0043620 | Biological Process | regulation of DNA-templated transcription in response to stress | ||||
| GO:0048527 | Biological Process | lateral root development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
MMKSDENSSY MGGLSASAAA GEKKMKVDKK SKKPRFAFQT RSQVDILDDG YRWRKYGQKA 60 VKNNRFPRSY YRCTHQGCNV KKQIQRLSKD EGIVVTTYEG MHSHPIQKST DNFEHILTQM 120 QIYTSF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 7e-29 | 37 | 104 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 7e-29 | 37 | 104 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00506 | DAP | Transfer from AT5G13080 | Download |
| |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009615508.1 | 1e-68 | PREDICTED: probable WRKY transcription factor 75 | ||||
| Refseq | XP_016446514.1 | 1e-68 | PREDICTED: probable WRKY transcription factor 75 | ||||
| Swissprot | Q9FYA2 | 1e-57 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | A0A0D5YAE6 | 2e-68 | A0A0D5YAE6_SALMI; WRKY protein | ||||
| STRING | XP_009615508.1 | 4e-68 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA2204 | 24 | 61 |




