PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100024130021

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

M-type_MADS

Protein Properties

Length: 62aa MW: 6954.22 Da PI: 11.3251

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100024130021	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91	6.1e-29	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n + rqvtfskRrng+lKKA+EL +LCda+va+iifsstgkly++++ Ote100024130021\|100024130021 10 RIDNVTSRQVTFSKRRNGLLKKAKELAILCDADVALIIFSSTGKLYDFAT 59 8***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.413	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.9E-39	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.19E-28	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.41E-37	2	60	No hit	No description
PRINTS	PR00404	3.8E-29	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.5E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.8E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.8E-29	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MGRGKIVIRR IDNVTSRQVT FSKRRNGLLK KAKELAILCD ADVALIIFSS TGKLYDFATT 60 PR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-19	1	60	1	60	MEF2C
5f28_B	1e-19	1	60	1	60	MEF2C
5f28_C	1e-19	1	60	1	60	MEF2C
5f28_D	1e-19	1	60	1	60	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269\|PubMed:17704216, ECO:0000269\|PubMed:24876250}.
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269\|PubMed:18579782}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_026433223.1	7e-34	MADS-box transcription factor 27-like isoform X6
Swissprot	A2RVQ5	2e-29	AGL16_ARATH; Agamous-like MADS-box protein AGL16
Swissprot	Q6Z6W2	2e-29	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A4D8YDP7	2e-31	A0A4D8YDP7_SALSN; MADS-box transcription factor, plant
STRING	EOY15523	5e-32	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yang K,Jiang M,Le J A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell. J Integr Plant Biol, 2014. 56(6): p. 539-49 [PMID:24386951] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]