![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100069650011 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 127aa MW: 14634.8 Da PI: 11.1299 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 88.4 | 9.8e-28 | 12 | 68 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
p++VNaKQy++I++RR +Rak+e+++ ++ rkpy+h SRh hA+rR+RgsgGrF
Ote100069650011|100069650011 12 RPIFVNAKQYNGIMRRRRSRAKAESKNHNMKMMRKPYMHLSRHLHAVRRQRGSGGRF 68
59**************************99**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 2.3E-25 | 9 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 30.31 | 10 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 7.0E-21 | 13 | 35 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.1E-23 | 13 | 68 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 15 | 35 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 7.0E-21 | 45 | 68 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MMLPLSMSSD GRPIFVNAKQ YNGIMRRRRS RAKAESKNHN MKMMRKPYMH LSRHLHAVRR 60 QRGSGGRFLS GKKGEKMQEN LSTESQASDG IHSTKAVSSE VTSYLHHFEF DRLHPSFLDV 120 GNDYLKV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 8e-14 | 13 | 73 | 4 | 63 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| 4g91_A | 6e-14 | 13 | 71 | 4 | 62 | HAPB protein |
| 4g92_A | 6e-14 | 13 | 71 | 4 | 62 | HAPB protein |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011094246.1 | 6e-32 | nuclear transcription factor Y subunit A-10 | ||||
| Refseq | XP_020553756.1 | 6e-32 | nuclear transcription factor Y subunit A-10 | ||||
| Refseq | XP_020553757.1 | 6e-32 | nuclear transcription factor Y subunit A-10 | ||||
| Swissprot | Q8VY64 | 6e-25 | NFYA4_ARATH; Nuclear transcription factor Y subunit A-4 | ||||
| TrEMBL | A0A4D8YVX0 | 1e-43 | A0A4D8YVX0_SALSN; Uncharacterized protein | ||||
| TrEMBL | A0A4D9C2M4 | 1e-43 | A0A4D9C2M4_SALSN; Uncharacterized protein | ||||
| STRING | VIT_08s0032g01190.t01 | 3e-26 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3706 | 23 | 47 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




