![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100076880061 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 122aa MW: 14177.3 Da PI: 9.3357 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 147.6 | 2.6e-46 | 3 | 98 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84
+eqd++lPianv+rimkk+lP akisk+ake +qec+sefi fvt+e sd+c +e+rkt+ng+d++wal++lGf++y +++
Ote100076880061|100076880061 3 EEQDKLLPIANVGRIMKKILPPSAKISKEAKERMQECASEFICFVTGEGSDRCLKENRKTMNGEDICWALTSLGFDNYSDAMV 85
69********************************************************************************* PP
NF-YB 85 vylkkyrelegek 97
yl++ re+++++
Ote100076880061|100076880061 86 RYLQRLREFQRQR 98
*********9976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.6E-43 | 3 | 111 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.88E-34 | 5 | 102 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.4E-23 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 5.4E-13 | 36 | 54 | No hit | No description |
| PRINTS | PR00615 | 5.4E-13 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 5.4E-13 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 122 aa Download sequence Send to blast |
MSEEQDKLLP IANVGRIMKK ILPPSAKISK EAKERMQECA SEFICFVTGE GSDRCLKENR 60 KTMNGEDICW ALTSLGFDNY SDAMVRYLQR LREFQRQRAN FNTINKEGAS QEIRMHKTKQ 120 IR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-37 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-37 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011092666.1 | 7e-61 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O82248 | 2e-45 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A022QNZ9 | 1e-55 | A0A022QNZ9_ERYGU; Uncharacterized protein (Fragment) | ||||
| TrEMBL | A0A2G9IB64 | 1e-55 | A0A2G9IB64_9LAMI; Uncharacterized protein | ||||
| STRING | Migut.N01995.1.p | 5e-56 | (Erythranthe guttata) | ||||
| STRING | Migut.O00508.1.p | 5e-56 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




