![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100086800001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 80aa MW: 9301.74 Da PI: 10.804 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 84.1 | 8.5e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr g++KKA+EL +LCda++a+i+fs tgkl++yss
Ote100086800001|100086800001 9 KKIDNLTSRQVTFSKRRRGLFKKAQELATLCDADIALIVFSDTGKLFDYSS 59
68***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 4.3E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.875 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.87E-33 | 3 | 60 | No hit | No description |
| PRINTS | PR00404 | 6.6E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 9.03E-28 | 3 | 65 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.6E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.6E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MVRQKIQIKK IDNLTSRQVT FSKRRRGLFK KAQELATLCD ADIALIVFSD TGKLFDYSSS 60 RWVRVESTSL TREFDSTKIQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 6e-18 | 1 | 65 | 1 | 65 | MEF2C |
| 5f28_B | 6e-18 | 1 | 65 | 1 | 65 | MEF2C |
| 5f28_C | 6e-18 | 1 | 65 | 1 | 65 | MEF2C |
| 5f28_D | 6e-18 | 1 | 65 | 1 | 65 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012828389.1 | 2e-33 | PREDICTED: MADS-box protein SVP-like | ||||
| Refseq | XP_020551410.1 | 2e-33 | MADS-box protein SVP isoform X3 | ||||
| Swissprot | Q9FUY6 | 7e-30 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
| TrEMBL | A0A022PUG2 | 4e-32 | A0A022PUG2_ERYGU; Uncharacterized protein | ||||
| TrEMBL | M1D728 | 4e-32 | M1D728_SOLTU; Uncharacterized protein | ||||
| STRING | Migut.B00557.1.p | 7e-33 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




