![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100090230021 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | ERF | ||||||||
| Protein Properties | Length: 118aa MW: 13574 Da PI: 5.8175 | ||||||||
| Description | ERF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | AP2 | 59.7 | 6.7e-19 | 15 | 67 | 2 | 56 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
+y+GVr + +g+++AeIrd s +g +r++lg+f taeeAa+a+++a+ +++g+
Ote100090230021|100090230021 15 KYRGVRKRQ-WGKYAAEIRDTSRQG-AARVWLGTFKTAEEAARAYDRAAYQMRGH 67
8*****888.**********43333.5**************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51032 | 22.958 | 15 | 74 | IPR001471 | AP2/ERF domain |
| SuperFamily | SSF54171 | 4.32E-21 | 15 | 75 | IPR016177 | DNA-binding domain |
| SMART | SM00380 | 1.5E-30 | 15 | 80 | IPR001471 | AP2/ERF domain |
| Pfam | PF00847 | 1.2E-13 | 15 | 67 | IPR001471 | AP2/ERF domain |
| Gene3D | G3DSA:3.30.730.10 | 1.4E-29 | 15 | 76 | IPR001471 | AP2/ERF domain |
| CDD | cd00018 | 1.99E-17 | 15 | 75 | No hit | No description |
| PRINTS | PR00367 | 3.0E-11 | 16 | 27 | IPR001471 | AP2/ERF domain |
| PRINTS | PR00367 | 3.0E-11 | 40 | 56 | IPR001471 | AP2/ERF domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MEESGSRKGD GGEVKYRGVR KRQWGKYAAE IRDTSRQGAA RVWLGTFKTA EEAARAYDRA 60 AYQMRGHLAI LNFPEEYNMP SSSSHFAAPS STERQVIEFE YYDDKLLEEL LDDNKRDN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5wx9_A | 7e-33 | 15 | 106 | 14 | 114 | Ethylene-responsive transcription factor ERF096 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025886110.1 | 2e-48 | ethylene-responsive transcription factor ERF098-like | ||||
| Swissprot | Q9LTC5 | 1e-37 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
| TrEMBL | A0A2G9I9T0 | 2e-56 | A0A2G9I9T0_9LAMI; Uncharacterized protein | ||||
| STRING | Solyc03g005500.1.1 | 8e-48 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA21 | 24 | 1165 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




