 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100145310041 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 48aa MW: 5312.97 Da PI: 6.5758 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42.1 | 2e-13 | 8 | 42 | 1 | 35 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35
+g+WT+eEd+ll+++v ++G g+W++++++ g gR
Ote100145310041|100145310041 8 KGPWTPEEDKLLLEYVGRYGEGRWSSVSKCAGVGR 42
79*****************************9777 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.143 | 3 | 48 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.4E-14 | 3 | 42 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.79E-11 | 3 | 42 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 5.5E-12 | 8 | 42 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 6.98E-8 | 10 | 39 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 48 aa Download sequence Send to blast |
MAEQSWRKGP WTPEEDKLLL EYVGRYGEGR WSSVSKCAGV GRAVGLDG |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004233658.3 | 2e-15 | myb-related protein 305 | ||||
| Refseq | XP_015065503.1 | 2e-15 | myb-related protein 340 | ||||
| TrEMBL | A0A059PRE0 | 1e-15 | A0A059PRE0_SALMI; MYB-related transcription factor | ||||
| STRING | POPTR_0004s11720.1 | 6e-15 | (Populus trichocarpa) | ||||
| STRING | Solyc02g089190.1.1 | 7e-15 | (Solanum lycopersicum) | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|