PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100147780061

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

M-type_MADS

Protein Properties

Length: 148aa MW: 16835.2 Da PI: 5.7286

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100147780061	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	72.5	3.5e-23	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+ien++n qvtfskRr g++KKA+E+ vLCd++ +i++s++g+l +s Ote100147780061\|100147780061 9 KKIENTTNLQVTFSKRRYGLIKKAYEIAVLCDIDLTLIMLSPSGRLSHFS 58 78********************************************9997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.6E-29	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	26.324	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.06E-23	2	84	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-21	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.3E-21	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-21	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-21	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010152	Biological Process	pollen maturation
GO:0080092	Biological Process	regulation of pollen tube growth
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 148 aa Download sequence Send to blast
MGRSKLPIKK IENTTNLQVT FSKRRYGLIK KAYEIAVLCD IDLTLIMLSP SGRLSHFSVE 60 DVIYRYINLS DRDRGGIIAN REQIVNTLAK IKTEKELAMQ SAATPGSDTE EIQKEIVDLQ 120 HQLEHAEYQL SVFEPDSDKF TSLAEFQS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
1tqe_Q	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
1tqe_R	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
1tqe_S	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
6byy_A	4e-15	1	71	1	74	MEF2 CHIMERA
6byy_B	4e-15	1	71	1	74	MEF2 CHIMERA
6byy_C	4e-15	1	71	1	74	MEF2 CHIMERA
6byy_D	4e-15	1	71	1	74	MEF2 CHIMERA
6bz1_A	4e-15	1	71	1	74	MEF2 CHIMERA
6bz1_B	4e-15	1	71	1	74	MEF2 CHIMERA
6bz1_C	4e-15	1	71	1	74	MEF2 CHIMERA
6bz1_D	4e-15	1	71	1	74	MEF2 CHIMERA
6c9l_A	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
6c9l_B	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
6c9l_C	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
6c9l_D	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
6c9l_E	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
6c9l_F	4e-15	1	71	1	74	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011097601.1	2e-86	agamous-like MADS-box protein AGL66
Swissprot	Q9LM46	2e-44	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	A0A4D9AL80	5e-84	A0A4D9AL80_SALSN; Uncharacterized protein
STRING	XP_010269101.1	3e-57	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA6183	19	25

Publications ? help Back to Top
Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]