![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100153590101 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 73aa MW: 8433.64 Da PI: 10.0407 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 98.9 | 3.3e-31 | 1 | 59 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+dDgy+WrKYG+K+vk+s++pr+Y++C+s gC+vkk+ver++ d ++v++tY+g+Hnh
Ote100153590101|100153590101 1 MDDGYKWRKYGKKMVKNSPNPRNYFKCSSGGCNVKKRVERDSLDASYVITTYQGKHNHA 59
69********************************************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF118290 | 6.54E-26 | 1 | 61 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.01 | 1 | 61 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.1E-33 | 1 | 60 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 5.0E-30 | 1 | 61 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.6E-24 | 2 | 58 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MDDGYKWRKY GKKMVKNSPN PRNYFKCSSG GCNVKKRVER DSLDASYVIT TYQGKHNHAS 60 PTCVLYCSRH TIL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-23 | 1 | 61 | 17 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-23 | 1 | 61 | 17 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027076705.1 | 7e-35 | probable WRKY transcription factor 50 isoform X2 | ||||
| Swissprot | Q8VWQ5 | 4e-29 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
| TrEMBL | A0A2G9FW18 | 1e-38 | A0A2G9FW18_9LAMI; Uncharacterized protein | ||||
| TrEMBL | A0A2G9H6L2 | 1e-38 | A0A2G9H6L2_9LAMI; Uncharacterized protein | ||||
| STRING | XP_008342835.1 | 3e-33 | (Malus domestica) | ||||
| STRING | XP_009779355.1 | 2e-33 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA2124 | 24 | 62 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




