![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100153750031 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 110aa MW: 13318.4 Da PI: 10.3346 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 29.1 | 1.7e-09 | 53 | 87 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55
k +yp++ ++ LA+ +gL+++q+ +WF N+R ++
Ote100153750031|100153750031 53 KWPYPTEVDKISLAETTGLDQKQINNWFINQRKRH 87
679*****************************985 PP
| |||||||
| 2 | ELK | 30.8 | 6.5e-11 | 7 | 28 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK++Llr Y+ +++sLkqEFs
Ote100153750031|100153750031 7 ELKDRLLRLYGDHINSLKQEFS 28
9********************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01188 | 5.6E-5 | 7 | 28 | IPR005539 | ELK domain |
| PROSITE profile | PS51213 | 9.655 | 7 | 27 | IPR005539 | ELK domain |
| Pfam | PF03789 | 1.7E-6 | 7 | 28 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 12.487 | 27 | 90 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 1.41E-19 | 28 | 100 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 4.2E-12 | 29 | 94 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 7.3E-28 | 32 | 91 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 3.67E-10 | 39 | 91 | No hit | No description |
| Pfam | PF05920 | 4.0E-18 | 47 | 86 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 65 | 88 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
MKTEDRELKD RLLRLYGDHI NSLKQEFSKK KKKGKLPKDA RQKLLEWWNV HYKWPYPTEV 60 DKISLAETTG LDQKQINNWF INQRKRHWKP SENMHLAMME NLSGHLFIGD |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011071110.1 | 3e-58 | homeobox protein knotted-1-like 6 isoform X1 | ||||
| Refseq | XP_020554838.1 | 1e-58 | homeobox protein knotted-1-like 6 isoform X2 | ||||
| Swissprot | Q84JS6 | 1e-50 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
| TrEMBL | A0A4D9AZR8 | 7e-59 | A0A4D9AZR8_SALSN; Uncharacterized protein | ||||
| STRING | XP_010248543.1 | 7e-53 | (Nelumbo nucifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA753 | 24 | 80 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




