PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100207870011

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

MYB_related

Protein Properties

Length: 135aa MW: 15827.1 Da PI: 9.3302

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100207870011	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.5	4e-15	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed +l+ ++ ++G +W++ +++ g++R++k+c++rw +yl Ote100207870011\|100207870011 14 KGAWSQDEDNKLKAYIMRYGHWNWRLLPKYAGLRRCGKSCRLRWVNYL 61 79****************99**********************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.9E-21	8	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.648	9	65	IPR017930	Myb domain
SMART	SM00717	2.4E-11	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	9.6E-14	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.56E-21	15	89	IPR009057	Homeodomain-like
CDD	cd00167	9.30E-9	16	61	No hit	No description
PROSITE profile	PS50090	3.973	62	117	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	1.2E-7	65	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 135 aa Download sequence Send to blast
MVRPPSFDSN GIKKGAWSQD EDNKLKAYIM RYGHWNWRLL PKYAGLRRCG KSCRLRWVNY 60 LKPGLKRGEF SKEEQDLVIK LHFELGNKYG DQLDSLLSDI LEAATNYNQI LELDYNWMAG 120 DDDRLILGVG RRKMD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-12	14	107	7	99	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in glucosinolates biosynthesis. {ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23943862}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011100326.1	2e-49	myb-related protein Myb4
Swissprot	Q9C9C8	5e-34	MY122_ARATH; Transcription factor MYB122
TrEMBL	A0A075BMN9	1e-49	A0A075BMN9_SALMI; MYB-related transcription factor
STRING	Migut.M00365.1.p	2e-45	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Guo R, et al. Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(18): p. 5707-19 [PMID:24151308] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Gigolashvili T MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana. Mol Plant, 2014. 7(5): p. 814-28 [PMID:24431192] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Peskan-Berghöfer T, et al. Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots. New Phytol., 2015. 208(3): p. 873-86 [PMID:26075497] Frerigmann H,Glawischnig E,Gigolashvili T The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 654 [PMID:26379682] Frerigmann H, et al. Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products. Mol Plant, 2016. 9(5): p. 682-695 [PMID:26802248] Stahl E, et al. Regulatory and Functional Aspects of Indolic Metabolism in Plant Systemic Acquired Resistance. Mol Plant, 2016. 9(5): p. 662-681 [PMID:26802249] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Xu J, et al. Pathogen-Responsive MPK3 and MPK6 Reprogram the Biosynthesis of Indole Glucosinolates and Their Derivatives in Arabidopsis Immunity. Plant Cell, 2016. 28(5): p. 1144-62 [PMID:27081184] Miao H, et al. Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation. Sci Rep, 2016. 6: p. 31854 [PMID:27549907]