PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100220160011
Organism
Ocimum tenuiflorum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family GRAS
Protein Properties Length: 35aa    MW: 3958.52 Da    PI: 4.1052
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100220160011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS28.81.5e-09232344374
                          GRAS 344 vksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   ++++gy++ eesg+l lgWkd +L+++SaW+
  Ote100220160011|100220160011   2 FPWQGYTLVEESGCLKLGWKDLSLLTASAWQ 32 
                                   6789**************************6 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035145.3E-7232IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 35 aa     Download sequence    Send to blast
MFPWQGYTLV EESGCLKLGW KDLSLLTASA WQPSD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276198.15e-18PREDICTED: scarecrow-like protein 23
TrEMBLA0A1U8B5N11e-16A0A1U8B5N1_NELNU; scarecrow-like protein 23
STRINGXP_010276198.12e-17(Nelumbo nucifera)