PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100231340001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family M-type_MADS
Protein Properties Length: 61aa    MW: 7065.21 Da    PI: 10.4603
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100231340001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.81.2e-32959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g++yey++
  Ote100231340001|100231340001  9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRVYEYAN 59
                                  79***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.908161IPR002100Transcription factor, MADS-box
CDDcd002652.29E-38260No hitNo description
SuperFamilySSF554551.23E-30260IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-34323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.1E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-342338IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-343859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRVYEYANN  60
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-22160160Myocyte-specific enhancer factor 2B
1tqe_Q4e-22160160Myocyte-specific enhancer factor 2B
1tqe_R4e-22160160Myocyte-specific enhancer factor 2B
1tqe_S4e-22160160Myocyte-specific enhancer factor 2B
6c9l_A4e-22160160Myocyte-specific enhancer factor 2B
6c9l_B4e-22160160Myocyte-specific enhancer factor 2B
6c9l_C4e-22160160Myocyte-specific enhancer factor 2B
6c9l_D4e-22160160Myocyte-specific enhancer factor 2B
6c9l_E4e-22160160Myocyte-specific enhancer factor 2B
6c9l_F4e-22160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022852794.18e-37agamous-like MADS-box protein AGL11 isoform X2
RefseqXP_022852795.18e-37agamous-like MADS-box protein AGL11 isoform X2
RefseqXP_022852796.18e-37agamous-like MADS-box protein AGL11 isoform X3
SwissprotQ407044e-36MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A124S2B02e-35A0A124S2B0_CYNCS; Transcription factor, MADS-box
STRINGMigut.C01334.1.p1e-35(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Publications ? help Back to Top
  1. Kyozuka J,Shimamoto K
    Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants.
    Plant Cell Physiol., 2002. 43(1): p. 130-5
    [PMID:11828031]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]