PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100234310001
Organism
Ocimum tenuiflorum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family GRAS
Protein Properties Length: 38aa    MW: 3967.62 Da    PI: 6.4486
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100234310001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS42.11.3e-13138123160
                          GRAS 123 lQWpaLlqaLasRpegppslRiTgvgspesgskeelee 160
                                   +QWpaL+qaLa R++gpp +++Tg+g+p+++++++l++
  Ote100234310001|100234310001   1 MQWPALMQALALRAGGPPAIKLTGIGPPQPDNTDALQQ 38 
                                   8******************************9999986 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035144.6E-11138IPR005202Transcription factor GRAS
PROSITE profilePS5098513.461138IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 38 aa     Download sequence    Send to blast
MQWPALMQAL ALRAGGPPAI KLTGIGPPQP DNTDALQQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001305514.18e-18DELLA protein GAI
RefseqXP_009590329.17e-18PREDICTED: DELLA protein GAI-like
RefseqXP_016572499.18e-18PREDICTED: DELLA protein GAI-like isoform X1
RefseqXP_016572500.18e-18PREDICTED: DELLA protein GAI-like isoform X2
SwissprotQ7Y1B61e-18GAI_SOLLC; DELLA protein GAI
TrEMBLQ8RUC45e-17Q8RUC4_WILGY; GIA/RGA-like gibberellin response modulator (Fragment)
STRINGXP_009590329.13e-17(Nicotiana tomentosiformis)
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]