![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100240980011 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | LFY | ||||||||
| Protein Properties | Length: 98aa MW: 11046.4 Da PI: 8.0154 | ||||||||
| Description | LFY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FLO_LFY | 169.5 | 3.1e-52 | 1 | 84 | 302 | 385 |
FLO_LFY 302 mrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChler 382
mrhYvhCYalhcLde as+alrra+ker+e +G+wrqacy+plvaiaa+qgwdi+a+f++hprLs+WYvP kLrqLCh++r
Ote100240980011|100240980011 1 MRHYVHCYALHCLDEPASDALRRAYKERNESIGSWRQACYEPLVAIAATQGWDIEAIFSHHPRLSVWYVPSKLRQLCHANR 81
9*******************************************************************************9 PP
FLO_LFY 383 ska 385
++
Ote100240980011|100240980011 82 ISS 84
876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF01698 | 1.2E-49 | 1 | 84 | IPR002910 | Floricaula/leafy protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MRHYVHCYAL HCLDEPASDA LRRAYKERNE SIGSWRQACY EPLVAIAATQ GWDIEAIFSH 60 HPRLSVWYVP SKLRQLCHAN RISSASTSAT TGGGEAHH |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2vy1_A | 7e-45 | 1 | 94 | 80 | 173 | PROTEIN LEAFY |
| 2vy2_A | 7e-45 | 1 | 94 | 80 | 173 | PROTEIN LEAFY |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Required for flower development. FLO may interact in a sequential manner with other homeotic genes affecting floral organ identity. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001280945.1 | 1e-48 | floricaula/leafy homolog | ||||
| Refseq | XP_023873133.1 | 2e-49 | protein UNIFOLIATA-like, partial | ||||
| Swissprot | P23915 | 5e-47 | FLO_ANTMA; Floricaula protein | ||||
| TrEMBL | W8VNP3 | 8e-48 | W8VNP3_PYRPY; LEAFY protein | ||||
| STRING | XP_008392692.1 | 5e-48 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA6668 | 23 | 33 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




