PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100244980091
Organism
Ocimum tenuiflorum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family ERF
Protein Properties Length: 173aa    MW: 19469.9 Da    PI: 8.4935
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100244980091genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP230.49.4e-1012412756
                           AP2 27 krkrfslgkfgtaeeAakaaiaarkklege 56
                                   +kr++lg+f tae Aaka+++a+  ++g+
  Ote100244980091|100244980091 12 FTKRIWLGTFETAEAAAKAYDEAAILMNGH 41
                                  46**********************998886 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103213.406148IPR001471AP2/ERF domain
SMARTSM003805.7E-12254IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.104.7E-17749IPR001471AP2/ERF domain
SuperFamilySSF541713.07E-111149IPR016177DNA-binding domain
PfamPF008471.7E-51341IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGILGVRNPP PFTKRIWLGT FETAEAAAKA YDEAAILMNG HTAKTNFPTA NHHDETASSL  60
SDILRAKLKK CCKNPAPSIT CLRLDNDSSN IGVWQKRAGR HSGSQWVMKV ELKKKQASVR  120
QXXXXXXXXX XXDVMMDEEN REALQMVEEL LYWNGSSASD DQXXXXXXIF KVN
Functional Description ? help Back to Top
Source Description
UniProtPromotes cuticle formation by inducing the expression of enzymes involved in wax biosynthesis (PubMed:15070782, PubMed:15319479). Confers drought resistance (PubMed:15319479). Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250, ECO:0000269|PubMed:15070782, ECO:0000269|PubMed:15319479}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019260506.11e-50PREDICTED: ethylene-responsive transcription factor SHINE 3-like
RefseqXP_019260507.11e-50PREDICTED: ethylene-responsive transcription factor SHINE 3-like
SwissprotQ9XI332e-42WIN1_ARATH; Ethylene-responsive transcription factor WIN1
TrEMBLA0A4D8ZSK51e-62A0A4D8ZSK5_SALSN; Uncharacterized protein
STRINGPGSC0003DMT4000777027e-50(Solanum tuberosum)
Publications ? help Back to Top
  1. Taketa S, et al.
    Barley grain with adhering hulls is controlled by an ERF family transcription factor gene regulating a lipid biosynthesis pathway.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(10): p. 4062-7
    [PMID:18316719]
  2. Al-Abdallat AM,Al-Debei HS,Ayad JY,Hasan S
    Over-expression of SlSHN1 gene improves drought tolerance by increasing cuticular wax accumulation in tomato.
    Int J Mol Sci, 2014. 15(11): p. 19499-515
    [PMID:25350113]
  3. Djemal R,Khoudi H
    Isolation and molecular characterization of a novel WIN1/SHN1 ethylene-responsive transcription factor TdSHN1 from durum wheat (Triticum turgidum. L. subsp. durum).
    Protoplasma, 2015. 252(6): p. 1461-73
    [PMID:25687296]
  4. Sadler C, et al.
    Wax and cutin mutants of Arabidopsis: Quantitative characterization of the cuticular transport barrier in relation to chemical composition.
    Biochim. Biophys. Acta, 2016. 1861(9 Pt B): p. 1336-1344
    [PMID:26965486]
  5. Sajeevan RS, et al.
    Expression of Arabidopsis SHN1 in Indian Mulberry (Morus indica L.) Increases Leaf Surface Wax Content and Reduces Post-harvest Water Loss.
    Front Plant Sci, 2017. 8: p. 418
    [PMID:28421085]