PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100246530041

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

MYB_related

Protein Properties

Length: 160aa MW: 18030.7 Da PI: 8.8307

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100246530041	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.4	1.4e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed+ll++++k++G g+W++ ++ g+ R++k+c++rw +yl Ote100246530041\|100246530041 14 KGAWTKQEDQLLIQYIKLHGQGCWRSLPKSAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.7E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.851	9	65	IPR017930	Myb domain
SMART	SM00717	2.7E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-16	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.97E-22	15	88	IPR009057	Homeodomain-like
CDD	cd00167	2.58E-12	16	61	No hit	No description
PROSITE profile	PS50090	4.077	62	86	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	6.0E-9	65	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MGRSPCCEKE HTNKGAWTKQ EDQLLIQYIK LHGQGCWRSL PKSAGLLRCG KSCRLRWINY 60 LRPDLKRGNF SQQEDELIIS LHSLLGNKKL ISSGIDPQTH THSINPKTLA MQALSNDVGF 120 RVIAAAEEEE YSRCSSYGVL SGNLLHPQIN LELSIRPPHL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	9e-15	13	88	26	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the negative regulation of flavonol biosynthesis. Represses the early phenylpropanoid genes, phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase (C4H) and 4-coumarate-CoA ligase (4CL), as well as the flavonoid-specific genes, flavonoid 3'-hydroxylase (F3'H) and dihydroflavonol 4-reductase (DFR) (PubMed:24319076). Plays a role in seed germination inhibition. Negatively regulates the expression of the abscisic acid (ABA) signaling transcription factor ABI5 in seeds (PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and osmotic stress (PubMed:25053018). Induced by salt stress (PubMed:24319076, PubMed:25053018). {ECO:0000269\|PubMed:24319076, ECO:0000269\|PubMed:25053018}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011097098.1	5e-60	myb-related protein 308
Refseq	XP_020215096.1	3e-60	myb-related protein 308
Swissprot	Q42379	4e-57	MYB7_ARATH; Transcription factor MYB7
TrEMBL	A0A059PSK2	7e-69	A0A059PSK2_SALMI; MYB-related transcription factor
STRING	VIT_07s0130g00040.t01	8e-59	(Vitis vinifera)
STRING	Migut.L00379.1.p	3e-59	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Lotkowska ME, et al. The Arabidopsis Transcription Factor MYB112 Promotes Anthocyanin Formation during Salinity and under High Light Stress. Plant Physiol., 2015. 169(3): p. 1862-80 [PMID:26378103] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]