PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ote100252210001

Organism

Ocimum tenuiflorum

Taxonomic ID

204149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum

Family

M-type_MADS

Protein Properties

Length: 89aa MW: 10377.6 Da PI: 10.4222

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ote100252210001	genome	OteDB	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	85.4	3.4e-27	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+i+n + rqvtfskRr g++KKAeEL vLCda+v +iifsstgkl+ey Ote100252210001\|100252210001 9 KKIDNVTARQVTFSKRRRGLFKKAEELAVLCDADVGLIIFSSTGKLFEYX 58 68**********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.0E-36	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.1	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	9.42E-27	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	9.26E-33	2	57	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-26	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-26	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MAREKIQIKK IDNVTARQVT FSKRRRGLFK KAEELAVLCD ADVGLIIFSS TGKLFEYXXX 60 XXXXXXXXXX XXXXXXXXXK ADPFKYKYS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	9e-18	1	57	1	57	MEF2C
5f28_B	9e-18	1	57	1	57	MEF2C
5f28_C	9e-18	1	57	1	57	MEF2C
5f28_D	9e-18	1	57	1	57	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343, ECO:0000269\|PubMed:25132385}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269\|PubMed:15659097, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18694458}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024028572.1	5e-32	MADS-box protein JOINTLESS isoform X1
Refseq	XP_024028573.1	5e-32	MADS-box protein JOINTLESS isoform X1
Refseq	XP_024028574.1	4e-32	MADS-box protein JOINTLESS isoform X2
Swissprot	Q9FVC1	9e-31	SVP_ARATH; MADS-box protein SVP
TrEMBL	A0A3G1VUM5	1e-30	A0A3G1VUM5_MORAL; Short vegetative phase
STRING	XP_009345714.1	3e-30	(Pyrus x bretschneideri)
STRING	cassava4.1_015543m	2e-30	(Manihot esculenta)
STRING	XP_009783886.1	3e-30	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Jaudal M, et al. Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago. J. Exp. Bot., 2014. 65(2): p. 429-42 [PMID:24249713] Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana. Plant Cell, 2014. 26(6): p. 2457-2471 [PMID:24920331] Hwan Lee J,Sook Chung K,Kim SK,Ahn JH Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering. Plant Signal Behav, 2014. 9(4): p. e28193 [PMID:25764420] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Müller-Xing R,Schubert D,Goodrich J Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(4): p. e1010868 [PMID:25924005] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Bechtold U, et al. Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis. Plant Cell, 2016. 28(2): p. 345-66 [PMID:26842464] Fernández V,Takahashi Y,Le Gourrierec J,Coupland G Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days. Plant J., 2016. 86(5): p. 426-40 [PMID:27117775] Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae. Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929 [PMID:28812948] Zou YP, et al. Adaptation of Arabidopsis thaliana to the Yangtze River basin. Genome Biol., 2017. 18(1): p. 239 [PMID:29284515] Richter R, et al. Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications. PLoS Genet., 2019. 15(4): p. e1008065 [PMID:30946745]