![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote100275430021 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 62aa MW: 7133.31 Da PI: 10.7049 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 99.1 | 1.8e-31 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rienk+nrqvtfskRr+g+lKKA+E+SvLCdaev +i+fs++gkl+eyss
Ote100275430021|100275430021 10 RIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVGLIVFSHKGKLFEYSS 59
8***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.268 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 4.8E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.92E-30 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.16E-37 | 2 | 61 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.9E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.4E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MGRGKVELRR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVGLIVFSH KGKLFEYSSD 60 SW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 7e-21 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_B | 7e-21 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_C | 7e-21 | 1 | 59 | 1 | 59 | MEF2C |
| 5f28_D | 7e-21 | 1 | 59 | 1 | 59 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1. {ECO:0000269|PubMed:10765981}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007156376.1 | 1e-34 | hypothetical protein PHAVU_003G2810000g, partial | ||||
| Refseq | XP_017969958.1 | 2e-34 | PREDICTED: truncated transcription factor CAULIFLOWER A isoform X2 | ||||
| Refseq | XP_021684192.1 | 5e-34 | truncated transcription factor CAULIFLOWER A-like isoform X2 | ||||
| Swissprot | Q6R4R9 | 8e-35 | CALA_BRAOB; Truncated transcription factor CAULIFLOWER A | ||||
| TrEMBL | A0A2K3PNA9 | 1e-34 | A0A2K3PNA9_TRIPR; Floral homeotic protein apetala 1-like | ||||
| TrEMBL | A0A4D9BPT2 | 4e-34 | A0A4D9BPT2_SALSN; MADS-box transcription factor, plant | ||||
| STRING | XP_004144163.1 | 4e-33 | (Cucumis sativus) | ||||
| STRING | XP_004165502.1 | 4e-33 | (Cucumis sativus) | ||||
| STRING | XP_004172815.1 | 5e-34 | (Cucumis sativus) | ||||
| STRING | XP_007156376.1 | 4e-34 | (Phaseolus vulgaris) | ||||
| STRING | Migut.E00037.1.p | 4e-33 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




