![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote237241650001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 104aa MW: 11831.2 Da PI: 8.2167 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 144.2 | 3.8e-45 | 11 | 103 | 1 | 93 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81
+CaaCk+lrrkC ++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+
Ote237241650001|237241650001 11 PCAACKFLRRKCLPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPHQREDAVNSLAYEADMRLRDPVYGCVGVIS 91
7******************************************************************************** PP
DUF260 82 klqqqleqlkae 93
lq+ql+ql+ +
Ote237241650001|237241650001 92 LLQHQLRQLQMD 103
*********987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 26.625 | 10 | 104 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.0E-44 | 11 | 104 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
MAXXXXXXTS PCAACKFLRR KCLPECVFAP YFPPDQPQKF ANVHKVFGAS NVTKLLNELQ 60 PHQREDAVNS LAYEADMRLR DPVYGCVGVI SLLQHQLRQL QMDL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 7e-55 | 10 | 104 | 10 | 104 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 7e-55 | 10 | 104 | 10 | 104 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012834587.1 | 4e-66 | PREDICTED: LOB domain-containing protein 6 | ||||
| Swissprot | Q32SG3 | 1e-58 | LBD6_MAIZE; LOB domain-containing protein 6 | ||||
| TrEMBL | A0A4D8Z3A9 | 2e-65 | A0A4D8Z3A9_SALSN; Uncharacterized protein | ||||
| STRING | Migut.F01828.1.p | 1e-65 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA43 | 24 | 669 |




