![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Ote237891870001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 56aa MW: 6220.27 Da PI: 9.4269 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 68 | 2.2e-21 | 10 | 55 | 1 | 46 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46
+CaaCk+lrrkC+++C+++ yfp e+p+kfanvhk+FGasnv kll
Ote237891870001|237891870001 10 PCAACKFLRRKCVPSCIFSSYFPPEEPHKFANVHKIFGASNVAKLL 55
7*******************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 17.427 | 9 | 56 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 9.7E-21 | 10 | 56 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 56 aa Download sequence Send to blast |
MASTSTYNPP CAACKFLRRK CVPSCIFSSY FPPEEPHKFA NVHKIFGASN VAKLLN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 5e-25 | 3 | 56 | 4 | 57 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 5e-25 | 3 | 56 | 4 | 57 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_014490594.1 | 7e-29 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_014490595.1 | 7e-29 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_022633199.1 | 7e-29 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_022633200.1 | 7e-29 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Refseq | XP_022633201.1 | 7e-29 | protein LATERAL ORGAN BOUNDARIES-like | ||||
| Swissprot | Q9FML4 | 2e-28 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | A0A4D9AFI1 | 3e-29 | A0A4D9AFI1_SALSN; Uncharacterized protein | ||||
| STRING | Migut.O00138.1.p | 4e-28 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA43 | 24 | 669 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




