![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PDK_30s1103021g001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 83aa MW: 9427.81 Da PI: 10.7131 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 76.5 | 2e-24 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+k rqv+fskRr g++KKA+EL vLCdaev + +fs +g+ ye++s
PDK_30s1103021g001 10 RIEDKASRQVSFSKRRSGLFKKAHELAVLCDAEVGISVFSASGRPYEFCS 59
8***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 28.847 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.3E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.03E-33 | 2 | 61 | No hit | No description |
| PRINTS | PR00404 | 1.9E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.24E-26 | 3 | 67 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.8E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MRRGKVQLRR IEDKASRQVS FSKRRSGLFK KAHELAVLCD AEVGISVFSA SGRPYEFCSS 60 SRMDDSYTFN TIPVLRQLSL TNP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| 3mu6_A | 5e-16 | 3 | 64 | 2 | 62 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 5e-16 | 3 | 64 | 2 | 62 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 5e-16 | 3 | 64 | 2 | 62 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 5e-16 | 3 | 64 | 2 | 62 | Myocyte-specific enhancer factor 2A |
| 6byy_C | 6e-16 | 1 | 64 | 1 | 63 | MEF2 CHIMERA |
| 6byy_D | 6e-16 | 1 | 64 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_A | 6e-16 | 1 | 64 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_B | 6e-16 | 1 | 64 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_C | 6e-16 | 1 | 64 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_D | 6e-16 | 1 | 64 | 1 | 63 | MEF2 CHIMERA |
| 6c9l_A | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 6e-16 | 1 | 64 | 1 | 63 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable MADS-box transcription factor that functions with J2 and EJ2 in meristem maturation. {ECO:0000269|PubMed:28528644}. | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008806429.1 | 8e-38 | MADS-box protein EJ2-like isoform X4 | ||||
| Swissprot | K4BND8 | 6e-24 | MADS4_SOLLC; MADS-box protein 04g005320 | ||||
| Swissprot | Q9XJ61 | 3e-24 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
| TrEMBL | A0A2H3Z038 | 2e-36 | A0A2H3Z038_PHODC; MADS-box protein EJ2-like isoform X4 | ||||
| STRING | XP_008806426.1 | 3e-36 | (Phoenix dactylifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G24260.3 | 1e-25 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




