PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PDK_30s1133011g004

Organism

Phoenix dactylifera

Taxonomic ID

42345

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix

Family

MYB

Protein Properties

Length: 191aa MW: 21978.6 Da PI: 6.9178

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PDK_30s1133011g004	genome	PDK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.8	6.9e-20	9	56	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv++v+ +G + W+t a++ g++R++k+c++rw++yl PDK_30s1133011g004 9 KGAWTAEEDQKLVEYVRAHGDKKWRTLAAKAGLNRCGKSCRLRWLNYL 56 79********************************************97 PP
2	Myb_DNA-binding	54.5	2.8e-17	62	107	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ +++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l PDK_30s1133011g004 62 RGNISQDEEDLIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNHWNTHL 107 7899****************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.488	4	60	IPR017930	Myb domain
SMART	SM00717	9.8E-16	8	58	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.52E-30	8	103	IPR009057	Homeodomain-like
Pfam	PF00249	7.1E-18	9	56	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.6E-25	10	63	IPR009057	Homeodomain-like
CDD	cd00167	9.83E-12	11	56	No hit	No description
PROSITE profile	PS51294	20.255	61	111	IPR017930	Myb domain
SMART	SM00717	3.2E-16	61	109	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-15	62	107	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-24	64	109	IPR009057	Homeodomain-like
CDD	cd00167	1.55E-11	66	107	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009957	Biological Process	epidermal cell fate specification
GO:0010090	Biological Process	trichome morphogenesis
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0048629	Biological Process	trichome patterning
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 191 aa Download sequence Send to blast
MATHSIVNKG AWTAEEDQKL VEYVRAHGDK KWRTLAAKAG LNRCGKSCRL RWLNYLRPGI 60 KRGNISQDEE DLIIRLHNLL GNRWSLIAGR LPGRTDNEIK NHWNTHLSRR PLTIDDLNLQ 120 QHRKHEDGYG HSHPSKTPIE PSLGFNSGVS EEDRFEAWLP YHDAELFDAW ADLSGSDFDV 180 EHLFDFMSMP G

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-31	9	110	7	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269\|PubMed:9839469}.
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017700090.1	1e-109	transcription repressor MYB5-like
Swissprot	Q38851	2e-53	MYB6_ARATH; Transcription repressor MYB6
Swissprot	Q9SZP1	4e-53	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A2H3ZUJ9	1e-108	A0A2H3ZUJ9_PHODC; transcription repressor MYB5-like
STRING	XP_008778866.1	2e-97	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP17778	5	10

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09460.1	9e-56	myb domain protein 6

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]