![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PDK_30s65509560g003 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 98aa MW: 11209.8 Da PI: 10.0719 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.3 | 6.2e-17 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT eEd ll +v+++G + W+ ++++ g++R++k+c++rw++yl
PDK_30s65509560g003 16 KGAWTVEEDALLRGCVEKYGAKEWRHVPQRAGLNRCRKSCRLRWLNYL 63
79*********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 4.6E-21 | 10 | 65 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 25.44 | 11 | 67 | IPR017930 | Myb domain |
| SMART | SM00717 | 8.4E-13 | 15 | 65 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.9E-16 | 16 | 63 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.54E-21 | 17 | 91 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.35E-10 | 18 | 63 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-5 | 66 | 90 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 98 aa Download sequence Send to blast |
MSFDSTNGTK QPGIRKGAWT VEEDALLRGC VEKYGAKEWR HVPQRAGLNR CRKSCRLRWL 60 NYLSPGINRG SFGEDEADLI VRLHKLLGNR QVTKEEPI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-14 | 12 | 90 | 3 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_026657506.1 | 6e-58 | transcription factor MYB114-like | ||||
| Swissprot | Q9FNV9 | 1e-34 | MY113_ARATH; Transcription factor MYB113 | ||||
| TrEMBL | A0A3Q0HSF8 | 1e-56 | A0A3Q0HSF8_PHODC; transcription factor MYB114-like | ||||
| STRING | XP_008779039.1 | 1e-59 | (Phoenix dactylifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP116 | 37 | 448 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G66370.1 | 4e-37 | myb domain protein 113 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




