![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PDK_30s795882g001 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 111aa MW: 12428.8 Da PI: 4.7268 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 171.1 | 1.2e-53 | 25 | 111 | 2 | 88 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88
reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+ea+dkcqrekrktingddllwa++tlGfedyveplkvyl+
PDK_30s795882g001 25 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEAADKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLH 111
89***********************************************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 6.5E-50 | 21 | 111 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.88E-37 | 27 | 111 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 8.9E-29 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.2E-18 | 58 | 76 | No hit | No description |
| PRINTS | PR00615 | 1.2E-18 | 77 | 95 | No hit | No description |
| PRINTS | PR00615 | 1.2E-18 | 96 | 111 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MPDSDNESGG QNNSNNNAGE YSSPREQDRF LPIANVSRIM KKALPANAKI SKDAKETVQE 60 CVSEFISFIT GEAADKCQRE KRKTINGDDL LWAMTTLGFE DYVEPLKVYL H |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 6e-48 | 19 | 111 | 1 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT017830 | 1e-116 | BT017830.1 Zea mays clone EL01N0508H10.c mRNA sequence. | |||
| GenBank | EU956383 | 1e-116 | EU956383.1 Zea mays clone 1561739 nuclear transcription factor Y subunit B-3 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008778301.1 | 3e-80 | nuclear transcription factor Y subunit B-3-like | ||||
| Refseq | XP_017702068.1 | 3e-80 | nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | Q75IZ7 | 2e-68 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A2H3X4U0 | 6e-79 | A0A2H3X4U0_PHODC; nuclear transcription factor Y subunit B-3-like | ||||
| STRING | XP_008778301.1 | 1e-79 | (Phoenix dactylifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 6e-62 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




