PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PDK_30s810761g002

Organism

Phoenix dactylifera

Taxonomic ID

42345

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix

Family

Protein Properties

Length: 167aa MW: 18098.9 Da PI: 9.782

Description

B3 family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PDK_30s810761g002	genome	PDK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	B3	62.3	8e-20	6	54	34	82
SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 l +ed++g+ W+++++y+++s++yv+tkGW++Fvk+++L++gD++ F PDK_30s810761g002 6 LSLCFEDRTGKPWQFRYSYWNSSQSYVMTKGWSRFVKDKRLDAGDTISF 54 46899******************************************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50863	11.716	1	67	IPR003340	B3 DNA binding domain
Gene3D	G3DSA:2.40.330.10	2.8E-21	2	56	IPR015300	DNA-binding pseudobarrel domain
SuperFamily	SSF101936	1.83E-17	3	56	IPR015300	DNA-binding pseudobarrel domain
CDD	cd10017	1.68E-15	4	54	No hit	No description
Pfam	PF02362	9.2E-17	6	54	IPR003340	B3 DNA binding domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 167 aa Download sequence Send to blast
MADKGLSLCF EDRTGKPWQF RYSYWNSSQS YVMTKGWSRF VKDKRLDAGD TISFCRGVLP 60 PMRNAASPGA CGDGGSYVYF QSVRPPPHVR VQVGGGGVVG LPMVLGSVPV IHGSAKPKRV 120 RLFGVNLECS EPEGLGEAQR LPLAQPRPPL LQRELGLLGL ESTVGLP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5os9_A	2e-25	3	58	42	97	B3 domain-containing transcription factor NGA1
5os9_B	2e-25	3	58	42	97	B3 domain-containing transcription factor NGA1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Regulates lateral organ growth. Functionally redundant with NGA2, NGA3 and NGA4. {ECO:0000269\|PubMed:16603651}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008788762.1	5e-98	B3 domain-containing protein Os02g0683500-like
Swissprot	O82799	1e-28	NGA1_ARATH; B3 domain-containing transcription factor NGA1
TrEMBL	A0A2H3XU14	1e-96	A0A2H3XU14_PHODC; B3 domain-containing protein Os02g0683500-like
STRING	XP_008788762.1	2e-97	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP583	37	168

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G36080.2	2e-26	B3 family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Lee BH, et al. The Arabidopsis thaliana NGATHA transcription factors negatively regulate cell proliferation of lateral organs. Plant Mol. Biol., 2015. 89(4-5): p. 529-38 [PMID:26433582] Lozano-Sotomayor P, et al. Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171] Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL Active suppression of a leaf meristem orchestrates determinate leaf growth. Elife, 2017. [PMID:27710768] Sasnauskas G,Manakova E,Lapėnas K,Kauneckaitė K,Siksnys V DNA recognition by Arabidopsis transcription factors ABI3 and NGA1. FEBS J., 2018. 285(21): p. 4041-4059 [PMID:30183137] Sato H, et al. Arabidopsis thaliana NGATHA1 transcription factor induces ABA biosynthesis by activating NCED3 gene during dehydration stress. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(47): p. E11178-E11187 [PMID:30397148]