![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PDK_30s912581g004 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 131aa MW: 14705.8 Da PI: 5.2553 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 182.6 | 3.1e-57 | 37 | 129 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy+eplk+yl+kyre
PDK_30s912581g004 37 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKLYLQKYRE 128
69*****************************************************************************************9 PP
NF-YB 93 l 93
+
PDK_30s912581g004 129 V 129
7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.7E-54 | 32 | 128 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.48E-39 | 40 | 129 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.8E-28 | 43 | 107 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 6.3E-23 | 71 | 89 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 74 | 90 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 6.3E-23 | 90 | 108 | No hit | No description |
| PRINTS | PR00615 | 6.3E-23 | 109 | 127 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
MHNIVNQLLW IDVGLGFPAD GGGTGEPGGD QSPRSTVREQ DRFLPIANIS RIMKKALPAN 60 AKIAKDAKET VQECVSEFIS FITSEASDKC QREKRKTING DDLLWAMATL GFEDYIEPLK 120 LYLQKYREVF L |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 1e-48 | 36 | 128 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-48 | 36 | 128 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ862214 | 2e-73 | KJ862214.1 Triticum aestivum eukaryotic transcription factor NF-Y subunit B2 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006361770.1 | 5e-70 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
| Swissprot | Q8VYK4 | 2e-64 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | M0ZNB5 | 2e-69 | M0ZNB5_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400004366 | 3e-70 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP201 | 38 | 331 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 5e-64 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




