PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PDK_30s931581g002

Organism

Phoenix dactylifera

Taxonomic ID

42345

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix

Family

HSF

Protein Properties

Length: 103aa MW: 11529 Da PI: 6.5159

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PDK_30s931581g002	genome	PDK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	76.4	4.8e-24	30	90	2	62
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 Fl+k+ye++e +e +++sw+e+g+ fvv+ ++ef++ +Lp+yFkh nfaSF+RQLn+Y PDK_30s931581g002 30 FLSKTYELVEGSEAPHVVSWNEEGTGFVVWLPQEFSQFILPRYFKHCNFASFIRQLNTYSL 90 9**********************************************************75 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46785	4.62E-21	25	90	IPR011991	Winged helix-turn-helix DNA-binding domain
Gene3D	G3DSA:1.10.10.10	5.3E-25	25	89	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	7.9E-16	26	102	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.5E-13	30	53	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	9.5E-20	30	90	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.5E-13	68	80	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.5E-13	81	93	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MEAGGETASA SNRPGRTPSP RGRGRSLAPF LSKTYELVEG SEAPHVVSWN EEGTGFVVWL 60 PQEFSQFILP RYFKHCNFAS FIRQLNTYSL DAQSLEGLIP VFY

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:9645433}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_026662383.1	2e-60	heat stress transcription factor B-4b-like
Swissprot	Q96320	4e-24	HSFB1_ARATH; Heat stress transcription factor B-1
TrEMBL	A0A3Q0I5X6	4e-59	A0A3Q0I5X6_PHODC; heat stress transcription factor B-4b-like
STRING	ERM95189	5e-28	(Amborella trichopoda)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP121	37	394

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G36990.1	4e-26	heat shock factor 4

Publications ? help Back to Top
Weng M, et al. Histone chaperone ASF1 is involved in gene transcription activation in response to heat stress in Arabidopsis thaliana. Plant Cell Environ., 2014. 37(9): p. 2128-38 [PMID:24548003] Nagashima Y,Iwata Y,Ashida M,Mishiba K,Koizumi N Exogenous salicylic acid activates two signaling arms of the unfolded protein response in Arabidopsis. Plant Cell Physiol., 2014. 55(10): p. 1772-8 [PMID:25138441] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Röth S,Mirus O,Bublak D,Scharf KD,Schleiff E DNA-binding and repressor function are prerequisites for the turnover of the tomato heat stress transcription factor HsfB1. Plant J., 2017. 89(1): p. 31-44 [PMID:27560701] Xu G, et al. uORF-mediated translation allows engineered plant disease resistance without fitness costs. Nature, 2017. 545(7655): p. 491-494 [PMID:28514448]