PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PDK_30s973521g001

Organism

Phoenix dactylifera

Taxonomic ID

42345

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix

Family

NAC

Protein Properties

Length: 168aa MW: 19565.6 Da PI: 9.6481

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PDK_30s973521g001	genome	PDK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	165.6	1.7e-51	11	140	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkd 89 +ppGfrFhPt+eel+++yLkkkv+ +k++l +vi+++d++k+ePwd++ k+ + ++ewyfFs++dkky+tg r+nrat++g+Wkatg+d PDK_30s973521g001 11 VPPGFRFHPTEEELLNYYLKKKVACEKIDL-DVIRDIDLNKIEPWDIQDncKIGSaPQNEWYFFSHKDKKYPTGMRANRATAAGFWKATGRD 101 69**************************.9***********952444333556***************************** PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 k +++++ + +g++ktLvfykgrap+g ++dW+mheyrl PDK_30s973521g001 102 KVIYAASFKRIGMRKTLVFYKGRAPHGLRSDWIMHEYRL 140 **99***************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.7E-52	6	147	IPR003441	NAC domain
PROSITE profile	PS51005	50.906	11	160	IPR003441	NAC domain
Pfam	PF02365	1.3E-27	12	140	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 168 aa Download sequence Send to blast
MSILANGHSC VPPGFRFHPT EEELLNYYLK KKVACEKIDL DVIRDIDLNK IEPWDIQDNC 60 KIGSAPQNEW YFFSHKDKKY PTGMRANRAT AAGFWKATGR DKVIYAASFK RIGMRKTLVF 120 YKGRAPHGLR SDWIMHEYRL DHPLYTNSSS NVSLLSFYFM ILITWPVP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	9e-45	10	152	16	154	NO APICAL MERISTEM PROTEIN
1ut4_B	9e-45	10	152	16	154	NO APICAL MERISTEM PROTEIN
1ut7_A	9e-45	10	152	16	154	NO APICAL MERISTEM PROTEIN
1ut7_B	9e-45	10	152	16	154	NO APICAL MERISTEM PROTEIN
3swm_A	9e-45	11	152	20	157	NAC domain-containing protein 19
3swm_B	9e-45	11	152	20	157	NAC domain-containing protein 19
3swm_C	9e-45	11	152	20	157	NAC domain-containing protein 19
3swm_D	9e-45	11	152	20	157	NAC domain-containing protein 19
3swp_A	9e-45	11	152	20	157	NAC domain-containing protein 19
3swp_B	9e-45	11	152	20	157	NAC domain-containing protein 19
3swp_C	9e-45	11	152	20	157	NAC domain-containing protein 19
3swp_D	9e-45	11	152	20	157	NAC domain-containing protein 19
4dul_A	9e-45	10	152	16	154	NAC domain-containing protein 19
4dul_B	9e-45	10	152	16	154	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269\|PubMed:16214898, ECO:0000269\|PubMed:17237351, ECO:0000269\|PubMed:17333250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008811882.1	1e-110	NAC domain-containing protein 43-like
Swissprot	Q84WP6	3e-82	NAC43_ARATH; NAC domain-containing protein 43
TrEMBL	A0A2H3ZCS5	1e-109	A0A2H3ZCS5_PHODC; NAC domain-containing protein 43-like
STRING	XP_008811882.1	1e-110	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1597	38	112

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46770.1	1e-84	NAC family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Gondolf VM, et al. A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis. BMC Plant Biol., 2014. 14: p. 344 [PMID:25492673] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Yuan Y,Teng Q,Zhong R,Ye ZH TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan. Plant Cell Physiol., 2016. 57(1): p. 35-45 [PMID:26556650] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Pascual MB, et al. PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine. Plant Biotechnol. J., 2018. 16(5): p. 1094-1104 [PMID:29055073] Liu C,Yu H,Li L SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana. PLoS Genet., 2019. 15(1): p. e1007928 [PMID:30657769]