| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 78.9 | 3.6e-25 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien + rqvt+skRr gi+KKAeEL vLCda+ ++iifss+gkl +++s
PEQU_00294 9 KKIENPTSRQVTYSKRRLGIMKKAEELTVLCDAQLSLIIFSSSGKLADFCS 59
68***********************************************96 PP
|
| 2 | K-box | 86 | 7.6e-29 | 71 | 169 | 1 | 99 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99
yq+ +g + ++a+++++q+ l++L++ ++nLq+e+R+++Ge+Le L +keL+ Leq+Le+s+k +R++K++++ +q+++ +kk k+ +++ +aL+++l+
PEQU_00294 71 YQNVTGIDIWDAQYQRMQNTLRNLREINRNLQKEIRQRKGENLEGLGVKELRGLEQKLEESVKIVRQRKYHVIATQTDTCRKKLKSSRQIYRALTHELQ 169
78899999**************************************************************************************99986 PP
|
| Protein Features
? help Back to Top |
 |
| Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
| PROSITE profile | PS50066 | 30.557 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 6.8E-35 | 2 | 94 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.20E-38 | 2 | 80 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.1E-21 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.2E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 6.4E-20 | 82 | 168 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 15.269 | 84 | 174 | IPR002487 | Transcription factor, K-box |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Tsai WC,Kuoh CS,Chuang MH,Chen WH,Chen HH
Four DEF-like MADS box genes displayed distinct floral morphogenetic roles in Phalaenopsis orchid. Plant Cell Physiol., 2004. 45(7): p. 831-44 [PMID:15295066] - Chen ZX, et al.
Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice. Planta, 2006. 223(5): p. 882-90 [PMID:16254725] - Zhang Q, et al.
Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull. J Genet Genomics, 2007. 34(6): p. 519-26 [PMID:17601611] - Yoshida H, et al.
superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] - Yao SG,Ohmori S,Kimizu M,Yoshida H
Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] - Xiao H, et al.
STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice. Plant J., 2009. 59(5): p. 789-801 [PMID:19453444] - Seok HY, et al.
Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] - Li H, et al.
Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] - Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T
Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] - Ohmori S,Tabuchi H,Yatou O,Yoshida H
Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation. Breed. Sci., 2012. 62(2): p. 124-32 [PMID:23136523] - Yun D, et al.
OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] - Lombardo F, et al.
The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]
|