PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_00615

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

WRKY

Protein Properties

Length: 69aa MW: 8400.61 Da PI: 10.5847

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_00615	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	78.6	7.1e-25	23	66	2	45
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSST CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedp 45 +Dgy+WrKY qK vk+s++prsYY Ct+++C+vkk+vers++dp PEQU_00615 23 KDGYRWRKYSQKAVKDSPYPRSYYHCTTQKCTVKKRVERSNQDP 66 8*****************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	6.0E-25	7	66	IPR003657	WRKY domain
SuperFamily	SSF118290	3.01E-21	14	67	IPR003657	WRKY domain
PROSITE profile	PS50811	22.641	17	69	IPR003657	WRKY domain
SMART	SM00774	4.7E-16	22	68	IPR003657	WRKY domain
Pfam	PF03106	3.0E-18	23	66	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 69 aa Download sequence Send to blast
KGKKRQREPR FAFMTKSEVD QLKDGYRWRK YSQKAVKDSP YPRSYYHCTT QKCTVKKRVE 60 RSNQDPLIE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-20	12	66	7	61	Probable WRKY transcription factor 4
2lex_A	1e-20	12	66	7	61	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020583702.1	5e-38	probable WRKY transcription factor 28 isoform X1
Refseq	XP_020583703.1	5e-38	probable WRKY transcription factor 28 isoform X2
Refseq	XP_020583704.1	4e-38	probable WRKY transcription factor 28 isoform X3
Swissprot	Q8VWJ2	2e-32	WRK28_ARATH; WRKY transcription factor 28
TrEMBL	A0A2P1JMM2	3e-36	A0A2P1JMM2_9ASPA; WRKY transcription factor 71-like (Fragment)
STRING	Gorai.009G157300.1	4e-34	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2125	37	96

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18170.1	7e-35	WRKY DNA-binding protein 28

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim SH, et al. Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis. Mol. Cells, 2014. 37(11): p. 833-40 [PMID:25358503] Zhao L, et al. KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535 [PMID:29288215]