PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_00615
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family WRKY
Protein Properties Length: 69aa    MW: 8400.61 Da    PI: 10.5847
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_00615genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.67.1e-252366245
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSST CS
        WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedp 45
                +Dgy+WrKY qK vk+s++prsYY Ct+++C+vkk+vers++dp
  PEQU_00615 23 KDGYRWRKYSQKAVKDSPYPRSYYHCTTQKCTVKKRVERSNQDP 66
                8*****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.0E-25766IPR003657WRKY domain
SuperFamilySSF1182903.01E-211467IPR003657WRKY domain
PROSITE profilePS5081122.6411769IPR003657WRKY domain
SMARTSM007744.7E-162268IPR003657WRKY domain
PfamPF031063.0E-182366IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
KGKKRQREPR FAFMTKSEVD QLKDGYRWRK YSQKAVKDSP YPRSYYHCTT QKCTVKKRVE  60
RSNQDPLIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-201266761Probable WRKY transcription factor 4
2lex_A1e-201266761Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020583702.15e-38probable WRKY transcription factor 28 isoform X1
RefseqXP_020583703.15e-38probable WRKY transcription factor 28 isoform X2
RefseqXP_020583704.14e-38probable WRKY transcription factor 28 isoform X3
SwissprotQ8VWJ22e-32WRK28_ARATH; WRKY transcription factor 28
TrEMBLA0A2P1JMM23e-36A0A2P1JMM2_9ASPA; WRKY transcription factor 71-like (Fragment)
STRINGGorai.009G157300.14e-34(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.17e-35WRKY DNA-binding protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kim SH, et al.
    Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis.
    Mol. Cells, 2014. 37(11): p. 833-40
    [PMID:25358503]
  4. Zhao L, et al.
    KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535
    [PMID:29288215]