![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_00874 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 109aa MW: 12498.2 Da PI: 10.1909 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 96.1 | 2.4e-30 | 25 | 83 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYG+K+vk+s++pr+YYrCts gC+vkk++er +ed ++v +tYeg H h+
PEQU_00874 25 LDDGYKWRKYGRKKVKDSPNPRNYYRCTSGGCNVKKRIERMREDSSYVLTTYEGIHSHH 83
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.2E-30 | 13 | 85 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 4.05E-27 | 18 | 85 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.435 | 20 | 85 | IPR003657 | WRKY domain |
| SMART | SM00774 | 3.3E-31 | 25 | 84 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.0E-22 | 26 | 83 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
SFMCRGRKEK IGRIAFITKS DIDKLDDGYK WRKYGRKKVK DSPNPRNYYR CTSGGCNVKK 60 RIERMREDSS YVLTTYEGIH SHHAPYTETT QPGAMAASSV MAALNGLNW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 4e-24 | 12 | 85 | 4 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 4e-24 | 12 | 85 | 4 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020591632.1 | 8e-59 | probable WRKY transcription factor 75 | ||||
| Swissprot | O22900 | 1e-30 | WRK23_ARATH; WRKY transcription factor 23 | ||||
| Swissprot | Q8VWQ5 | 4e-31 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
| Swissprot | Q93WV4 | 7e-31 | WRK71_ARATH; WRKY transcription factor 71 | ||||
| Swissprot | Q9FGZ4 | 1e-30 | WRK48_ARATH; Probable WRKY transcription factor 48 | ||||
| TrEMBL | A0A3Q0HNJ9 | 2e-38 | A0A3Q0HNJ9_PHODC; probable WRKY transcription factor 75 isoform X1 | ||||
| STRING | Gorai.007G245200.1 | 5e-37 | (Gossypium raimondii) | ||||
| STRING | Gorai.011G114200.1 | 4e-37 | (Gossypium raimondii) | ||||
| STRING | cassava4.1_016594m | 6e-37 | (Manihot esculenta) | ||||
| STRING | XP_010261070.1 | 7e-37 | (Nelumbo nucifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP441 | 37 | 206 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26170.1 | 2e-33 | WRKY DNA-binding protein 50 | ||||




