![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_01588 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 53aa MW: 5888.07 Da PI: 9.9672 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 82.2 | 5.6e-26 | 9 | 53 | 4 | 48 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkk 48
+++e+kGlnP livllv+ +lll+f+vgny+lyvyaqk+lPP+kk
PEQU_01588 9 VEEESKGLNPSLIVLLVIVTLLLLFFVGNYALYVYAQKTLPPKKK 53
68999***************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 2.0E-4 | 7 | 48 | No hit | No description |
| Pfam | PF04689 | 4.1E-23 | 10 | 53 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 53 aa Download sequence Send to blast |
AKQGNNVIVE EESKGLNPSL IVLLVIVTLL LLFFVGNYAL YVYAQKTLPP KKK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020597176.1 | 4e-27 | DNA-binding protein S1FA | ||||
| Swissprot | P42553 | 5e-19 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | J3LXK2 | 9e-17 | J3LXK2_ORYBR; Uncharacterized protein | ||||
| STRING | OB04G18770.1 | 2e-17 | (Oryza brachyantha) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5154 | 35 | 63 |




