![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_03888 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 108aa MW: 12219.2 Da PI: 10.174 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 57.2 | 2.2e-18 | 14 | 47 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
C++C kTp+WR gp g+ktLCnaCG++y++ +
PEQU_03888 14 CTHCDIQKTPQWRAGPMGPKTLCNACGVRYKSGR 47
*******************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 4.4E-17 | 8 | 58 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 2.6E-15 | 12 | 45 | IPR013088 | Zinc finger, NHR/GATA-type |
| PROSITE profile | PS50114 | 11.055 | 12 | 44 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.09E-15 | 12 | 71 | No hit | No description |
| CDD | cd00202 | 1.68E-12 | 13 | 70 | No hit | No description |
| Pfam | PF00320 | 4.1E-16 | 14 | 48 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 14 | 39 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0007623 | Biological Process | circadian rhythm | ||||
| GO:0009845 | Biological Process | seed germination | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
MKKEDEYVPS VRKCTHCDIQ KTPQWRAGPM GPKTLCNACG VRYKSGRLFP EYRPAASPTF 60 VPAVHSNSHK KVVEMRLRGL EMVGNNGGKE VTVAAKNCDL LQYIRRRE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020570577.1 | 2e-73 | GATA transcription factor 4-like | ||||
| Swissprot | Q9SV30 | 7e-38 | GATA8_ARATH; GATA transcription factor 8 | ||||
| TrEMBL | A0A2I0WYA4 | 2e-64 | A0A2I0WYA4_9ASPA; GATA transcription factor 8 | ||||
| STRING | GSMUA_Achr2P02830_001 | 3e-49 | (Musa acuminata) | ||||
| STRING | GSMUA_Achr9P20700_001 | 1e-47 | (Musa acuminata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5169 | 34 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54810.2 | 3e-40 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




