PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_06080

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

NAC

Protein Properties

Length: 165aa MW: 19467.2 Da PI: 8.6822

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_06080	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	165.4	2.1e-51	11	140	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 +pp+frFhPt+eel+ +yLkkkv++++++l +vi+e+d++k+ePwd+++ ++ + +e++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk + + PEQU_06080 11 VPPCFRFHPTEEELLAYYLKKKVASENIDL-NVIHEIDLNKLEPWDIQEkcRIGSrDENDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVINACC 108 59**************************.99**********952444443556**********************************99 PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 + +g++ktLvfy+grap+gek+dW+mheyrl PEQU_06080 109 FKRIGMRKTLVFYRGRAPRGEKSDWIMHEYRL 140 99**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.48E-53	7	146	IPR003441	NAC domain
PROSITE profile	PS51005	50.564	11	161	IPR003441	NAC domain
Pfam	PF02365	2.1E-27	12	140	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 165 aa Download sequence Send to blast
MSISINGLSK VPPCFRFHPT EEELLAYYLK KKVASENIDL NVIHEIDLNK LEPWDIQEKC 60 RIGSRDENDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKVINACCFK RIGMRKTLVF 120 YRGRAPRGEK SDWIMHEYRL DEHELHGSDC QSNVYIYIYI PSYFS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	5e-46	11	140	15	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of genes involved in biosynthesis of secondary walls. Together with NST1, required for the secondary cell wall thickening and lignification of sclerenchymatous fibers and secondary xylem vessels (tracheary elements). Seems to repress the secondary cell wall thickening of xylary fibers. May also regulate the secondary cell wall lignification of other tissues. Binds to and activates the promoter of MYB46. {ECO:0000269\|PubMed:17114348, ECO:0000269\|PubMed:17237351, ECO:0000269\|PubMed:17333250, ECO:0000269\|PubMed:17565617, ECO:0000269\|PubMed:17890373}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020573837.1	1e-114	NAC domain-containing protein 43-like
Swissprot	Q9LPI7	2e-80	NAC12_ARATH; NAC domain-containing protein 12
TrEMBL	A0A2I0WI52	2e-83	A0A2I0WI52_9ASPA; NAC domain-containing protein 43
TrEMBL	A0A444DN56	2e-83	A0A444DN56_ENSVE; Uncharacterized protein
STRING	EMJ22054	6e-83	(Prunus persica)
STRING	Solyc10g005010.2.1	3e-83	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1597	38	112

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G32770.1	2e-72	NAC domain containing protein 12

Publications ? help Back to Top
Zhao Q, et al. Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis. Phytochemistry, 2015. 112: p. 170-8 [PMID:25107662] Fernández-Pérez F,Vivar T,Pomar F,Pedreño MA,Novo-Uzal E Peroxidase 4 is involved in syringyl lignin formation in Arabidopsis thaliana. J. Plant Physiol., 2015. 175: p. 86-94 [PMID:25506770] Sakamoto S,Mitsuda N Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant. Plant Cell Physiol., 2015. 56(2): p. 299-310 [PMID:25535195] Yuan Y,Teng Q,Zhong R,Ye ZH TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan. Plant Cell Physiol., 2016. 57(1): p. 35-45 [PMID:26556650] Huang J,Chen F,Wu S,Li J,Xu W Cotton GhMYB7 is predominantly expressed in developing fibers and regulates secondary cell wall biosynthesis in transgenic Arabidopsis. Sci China Life Sci, 2016. 59(2): p. 194-205 [PMID:26803299] Pascual MB, et al. PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine. Plant Biotechnol. J., 2018. 16(5): p. 1094-1104 [PMID:29055073]