PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_11845

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

WRKY

Protein Properties

Length: 145aa MW: 16405.4 Da PI: 9.7653

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_11845	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	107.3	7.6e-34	10	67	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers++dp++v++tYeg+H+h+ PEQU_11845 10 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCTVKKRVERSNQDPSIVITTYEGQHTHH 67 8********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.7E-33	2	69	IPR003657	WRKY domain
SuperFamily	SSF118290	1.24E-29	3	69	IPR003657	WRKY domain
PROSITE profile	PS50811	31.663	4	69	IPR003657	WRKY domain
SMART	SM00774	4.2E-39	9	68	IPR003657	WRKY domain
Pfam	PF03106	3.7E-27	10	67	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 145 aa Download sequence Send to blast
MTKSEVDHLE DGYRWRKYGQ KAVKNSPYPR SYYRCTTQKC TVKKRVERSN QDPSIVITTY 60 EGQHTHHCPA NVRGSSHLLA NQTSSMAMQS FRTELFGQQL SQLGSTSSGY GFLQTLSSPS 120 QQLQIPNYGA LLQDIMPSFI KSSHP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-30	2	70	10	78	Probable WRKY transcription factor 4
2lex_A	2e-30	2	70	10	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00440	DAP	Transfer from AT4G18170	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020583702.1	1e-105	probable WRKY transcription factor 28 isoform X1
Refseq	XP_020583703.1	1e-105	probable WRKY transcription factor 28 isoform X2
Refseq	XP_020583704.1	1e-105	probable WRKY transcription factor 28 isoform X3
Swissprot	Q8VWJ2	1e-45	WRK28_ARATH; WRKY transcription factor 28
TrEMBL	A0A2P1JMM2	3e-93	A0A2P1JMM2_9ASPA; WRKY transcription factor 71-like (Fragment)
STRING	XP_008777186.1	4e-58	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP623	37	173

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29860.1	7e-45	WRKY DNA-binding protein 71

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim SH, et al. Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis. Mol. Cells, 2014. 37(11): p. 833-40 [PMID:25358503] Zhao L, et al. KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535 [PMID:29288215]