![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PEQU_12386 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 62aa MW: 7272.41 Da PI: 9.88 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 46.3 | 9.6e-15 | 18 | 49 | 25 | 56 |
G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRla 56
++A+Pkti +lm+v+gLt+e+v S LQkYRl+
PEQU_12386 18 KNAVPKTIIQLMNVDGLTRENVVSQLQKYRLY 49
79****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.02E-7 | 16 | 52 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-14 | 16 | 53 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 4.0E-10 | 18 | 48 | IPR006447 | Myb domain, plants |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MQGLFDETTE ISARTQYKNA VPKTIIQLMN VDGLTRENVV SQLQKYRLYV KRYKDSVNHL 60 LI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16164597}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_023732561.1 | 8e-15 | transcription factor PCL1-like | ||||
| Refseq | XP_023732562.1 | 8e-15 | transcription factor PCL1-like | ||||
| Swissprot | Q94DH3 | 7e-16 | PCL1_ORYSJ; Transcription factor PCL1 | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1620 | 34 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G46640.2 | 1e-16 | G2-like family protein | ||||




